SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008231 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008231
Domain Number 1 Region: 257-493
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-57
Family DBL homology domain (DH-domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 494-615
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-32
Family Pleckstrin-homology domain (PH domain) 0.0005
Further Details:      
 
Domain Number 3 Region: 65-131
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000329
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 
Domain Number 4 Region: 633-683
Classification Level Classification E-value
Superfamily Chorismate mutase II 0.0000513
Family Dimeric chorismate mutase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008231   Gene: ENSLACG00000007285   Transcript: ENSLACT00000008297
Sequence length 1027
Comment pep:known_by_projection scaffold:LatCha1:JH127704.1:267787:412027:1 gene:ENSLACG00000007285 transcript:ENSLACT00000008297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLHDNKPVRSFSSLFLSLRREEKKYSKERGEKMSRVEVLAKARNERIREIAIKNREKE
KMKEREKEAKEKEARYTNGHLFNSITVSGLTQCYACNKSITAKEALICPTCNVTIHNRCK
DTLANCTKVKQKQQKAALVKNSSALQTVALRNKSTLIKDRPSSAVYLSDSFRQSLLGSRR
GRTTITLSKSVSTTNIAGNWNDDSPLGLRRILSQSTDSLNIKNRTLSVESLIDEGAEVIY
NQLMGNLETDEKDFEADSWSLAVDTNFLQQHRKDIIKRQDVIYELIQTELHHVRTLKIMS
DIFRKGMLEDLSMDQTLVHSMFPVLDELSDLHVRFLSQLLERRKDSLVSNSNKNFVINRL
GDILVTQFSGTNAEQMKKAYKEFCSRHTKAVKLYKELFTRDKRFQQFIRRMTRSTVLRRH
GIQECILLVTQRLTKYPVLIDRILQNTKGNEEDSRDLAQALSLIKDLIFTVDQEVFECEK
SLRLQEIYNRVDSKAVGVVHGGRLFRKEEFQRRKLIHDGFMLWKNSSGRFKDVQVLLMTD
VLVFLQEKDQKYTFPSMDKPSVISLQNLIVRDIANQERGIFLISAASPPEMYEILAASKD
ERNTWMKMIKHTVSTCPKREEFPLIETEDEVLLRNLKDEIQQKDREIQELLEERVNLFSE
VLQLQASQEVPLNPNSRNLFRSDSANSLKGEKLITEAIKEVEKLKDLLVGGSVELSVSVV
DGDRNECLSSEGTRQHSSDATNGENGGVNGQPDFRRTSISVQKDRNGNQLQQRSPQEEVY
QSLVNIYSFLHGLQAVVVQQDTLLELCIQEVVDKKEKLTRSNSRDGPLGDPGSKTTEKTS
NELNLLQRQHILLQEELSRCRKACEEKAQEARELQARLQGSEAAKVALQDSKGQEGGVAH
PEVVMRNKKHSHVRRCSLPSPDLLHLNFTPLQVPQQRRGSDVTVVPLTPTSPLQSNLDCV
PTKEIEDDEVARLHEQSDLEMNSDTECDGQRSTPPSPREYQRMQDITEEEEGSQEVREEG
SNPTTDP
Download sequence
Identical sequences H3AF10
XP_006005168.1.90931 ENSLACP00000008231 ENSLACP00000008231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]