SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008453 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008453
Domain Number 1 Region: 393-437,491-559
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000262
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008453   Gene: ENSLACG00000007484   Transcript: ENSLACT00000008521
Sequence length 571
Comment pep:known_by_projection scaffold:LatCha1:JH127840.1:279390:296154:1 gene:ENSLACG00000007484 transcript:ENSLACT00000008521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEEELSLSDSEGGLAGERWAPVGAVASPEEEAEKPEKCGGGSSALAPAMAEKLRRLEE
EQELLNSSLLALTSHFAQVQFRLKQIVRASQSEEKERLLLELEEFAFKGCPHVLGCRAQD
AQLLEDSSDREKRERLQAQRQKQRELIVQLKTQLDDLERFAYQEGNYDTLPQSVMMERQR
VIIDELIKKLDVNFNEDIGSLSPEELRQRVDAAIAQIVNPARVKEQLVDQLKTQIRDLEM
FINFIQDEVGSPPLPQHGHCSCSTHGKGDCKHTNAKMPSGNSKVEPEQAKKMRETSLHLM
RRALAVLQIFAVSQFGCATGQIPRGLWQQDEANQDYAPLLQKLESSVDKVRQLALKRQQP
NEHVISYSSIQDISLGGKDELTTAVRKELAMALRDLMSHGLYMSSQGMSLVLAPISCLLP
FSSSPQTMHPWDLFVKYYNTKNGRAFVESPARKLSQSFALPVTGGAVVTPKQSLLTAVNT
VLTEHDPFKRSADSEFKALVCMALNEQRLVSWVNLICKSGVLVQNHYQPWSYMVQTGFES
ALNILSRLSNLQFSLPVDLAVRQLKNIKDAF
Download sequence
Identical sequences H3AFN2
XP_006006019.1.90931 ENSLACP00000008453 ENSLACP00000008453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]