SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008454 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008454
Domain Number 1 Region: 390-434,488-556
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000248
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008454   Gene: ENSLACG00000007484   Transcript: ENSLACT00000008522
Sequence length 568
Comment pep:known_by_projection scaffold:LatCha1:JH127840.1:279661:292106:1 gene:ENSLACG00000007484 transcript:ENSLACT00000008522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWAPVGAVASPEEEAEKPEKCGGGSSALAPAMAEKLRRLEEEQELLNSSLLALTSHFAQV
QFRLKQIVRASQSEEKERLLLELEEFAFKGCPHVLGCRAQDAQLLEDSVGRPYHDSDRAK
GSEQSDREKRERLQAQRQKQRELIVQLKTQLDDLERFAYQEGNYDTLPQSVMMERQRVII
DELIKKLDVNFNEDIGSLSPEELRQRVDAAIAQIVNPARVKEQLVDQLKTQIRDLEMFIN
FIQDEVGSPPLPQHGHCSCSTHGKGDCKHTNAKMPSGNSKVEPEQAKKMRETSLHLMRRA
LAVLQIFAVSQFGCATGQIPRGLWQQDEANQDYAPLLQKLESSVDKVRQLALKRQQPNEH
VISYSSIQDISLGGKDELTTAVRKELAMALRDLMSHGLYMSSQGMSLVLAPISCLLPFSS
SPQTMHPWDLFVKYYNTKNGRAFVESPARKLSQSFALPVTGGAVVTPKQSLLTAVNTVLT
EHDPFKRSADSEFKALVCMALNEQRLVSWVNLICKSGVLVQNHYQPWSYMVQTGFESALN
ILSRLSNLQFSLPVDLAVRQLKNIKDAF
Download sequence
Identical sequences H3AFN3
ENSLACP00000008454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]