SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008543 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008543
Domain Number 1 Region: 331-582
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-79
Family Protein kinases, catalytic subunit 0.0000000845
Further Details:      
 
Domain Number 2 Region: 162-285
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.85e-37
Family Synaptotagmin-like (S variant) 0.0000048
Further Details:      
 
Domain Number 3 Region: 27-89
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.63e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 100-156
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008543   Gene: ENSLACG00000007559   Transcript: ENSLACT00000008611
Sequence length 683
Comment pep:known_by_projection scaffold:LatCha1:JH128664.1:283966:340331:-1 gene:ENSLACG00000007559 transcript:ENSLACT00000008611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSDSPGGGGGAGGGAAPVFRFYRKGALRQKNVHEVNNHQFIARFFKQPTFCSHCTDFIW
GIGKQGFQCQVCSFVVHKRCHEFVSFQCPGAGKGPNICDHRSKHKFKPHTYSSPTFCDHC
GSLLYGLVHQGMKCSGCEMNVHKRCVMSVPSLCGMDHTERRGRIYIKAEIQDGEELHVTV
DEARNLIPMDPNGLSDPYVKLKLIPDPKNQSKQKTKTVRSTLNPTWNENFVFILKPSDKD
RRLSVEVWDWDRTSRNDFMGALSFGISELYKTPVDGWFKLLNQEEGEYYNVPISDDVNTE
LQLKFEACNFPFEFYEKENMTPPPNIMTPTEGKRASLYGNSGRFRMSDFNFLMVLGKGSF
GKVMLAERRGTDELYAIKVLKKDVIIQDDDVECTMVEKRVLALAERPHFLTYLHSTFQTV
DRLYFVMEYVNGGDLMYHIQQVGKFKEPHAAFYAAEIAIGLFFLHNKGIIYRDLKLDNVM
LDSEGHIKITDFGMCKEDIYDGATTRTFCGTPDYIAPEIIAYQAYGKSVDWWAFGVLLYE
MLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSREAVAICKGVQKEDQTAPLGTEPAERIK
LPHSGLNRQRGSNKKHTQPFYPKQCGRNGENFDKFFTRVPPVLTPPDQLVLASIDQSDFR
GFTFVNPEFQHASQRCSAPISVV
Download sequence
Identical sequences H3AFX2
ENSLACP00000008543 ENSLACP00000008543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]