SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008545 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008545
Domain Number 1 Region: 212-340,656-829
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.46e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 1038-1103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.14e-19
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 3 Region: 113-182
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000265
Further Details:      
 
Domain Number 4 Region: 53-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 
Domain Number 5 Region: 8-67
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000588
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008545   Gene: ENSLACG00000007561   Transcript: ENSLACT00000008613
Sequence length 1111
Comment pep:known_by_projection scaffold:LatCha1:JH126822.1:284095:333300:1 gene:ENSLACG00000007561 transcript:ENSLACT00000008613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNVNNFSSIITPCRKLILCADNRKEMEDWIAALKSVQNGEHFESTQYSMDHFSGMHNWYA
CSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGISMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKELLPTKCPL
GQCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNP
AQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDNLNLHKQCQLGVLPLGT
GNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKLPRQASSFTVTEDY
SEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTES
SEESEVMARKCSVLKEKLDSLLKTLSDESQAAPSRPNPPPTIAEEQEDGEGSGNTCESTS
ERSTTAACSTRPQIFRPREQLMLRANSLKKAIRQIIEHAEKAVDEQNAQTQEGFLLSLSS
EEQLRVARNEEKILLQSSHSSNYTSSVHKGKSCRKVPKPPCERLISKGSLSLGSTASLPA
QTGYRDNMPMLNAKILYPNFRPGMSGSLPGSSVISRLLISADPCNAEPESMDCYTEKCVM
NNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLE
CDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFTAPSFDDKILEVVAVFGSMQMA
VSRVINLQHHRIAQCRTVKITILGDEGVPVQVDGEAWIQPPGYIRIVHKNRAQTLTRDRA
FENTLKSWEDKQKCEIPRVSSQHALHPEIVSEDEALQINQFGQSAGALIHSIREIALSHH
DMEQELAHAVNASSKSMDKVYAKSKTTEGLNCGLVIEMVNNVKALHNETELLLAGKMSLV
LDPPQKEQLSSALANVDLQFRKLTEIPWLCQLVEPSDEESQMMDYSKRTRSAKFRLVPKF
KKEKNNKNKEMRSSMALPVHLWGTEEVAAWLEHLSLCEYKDIFIRHDIRGSELLHLERRD
LKDLGVTKVGHMKRILHGIKELSRSSPVSEV
Download sequence
Identical sequences H3AFX4
ENSLACP00000008545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]