SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008734 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008734
Domain Number 1 Region: 12-145
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.7e-30
Family Hormone receptor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 136-419
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000284
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008734   Gene: ENSLACG00000007720   Transcript: ENSLACT00000008802
Sequence length 519
Comment pep:known_by_projection scaffold:LatCha1:JH126663.1:294512:323319:-1 gene:ENSLACG00000007720 transcript:ENSLACT00000008802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVELPRTFLLAVLLLSHAESIAGKTAQDMFQEWKRYEKECEQKMATDPYPTGLFCNRTFD
MYVCWPDGPPNTTVKVPCPWFLPWQEKVQNGSVFRKCGPGGHWVTDSSGLPWRDHSQCGY
VDEEIQIQKKVKILDHFRVMYTVGYSLSLAALVLALITLLAFRKLRCTRNYIHMNLFASF
ILRAISILMRDALLKTHIKQEIKNEGDIFNLLSDQAAVGCRLAQVLMQYCVGANYYWLLV
EGLYLHNLLVVMVLSEKSYFRGYLLIGWGAPVLFVVPWVLVRYFHENTQCWERNDNMAYW
WIIRFPILLAILINFFIFIRIIKILISKLRAHQMRYNNYKCRLAKSTLTLIPLLGIHKLV
FEFVTEEQAKGTLRYVKLFFELFLNSFQGLLVAILYCFVNKEVQSEISKKWQRRKLGMSL
LEENRHTCSNAPQGQGTGSGHRHHRPGSSCKACQREKNGKLSNDSNYSSENSSSGHHHSG
AKNSKSFCYISTKKLPPATNHTDRVMGEKPLVKVSESYC
Download sequence
Identical sequences H3AGG3
ENSLACP00000008734 XP_005991637.1.90931 XP_005991638.1.90931 XP_014341373.1.90931 XP_014341374.1.90931 XP_014341375.1.90931 ENSLACP00000008734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]