SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009173 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000009173
Domain Number - Region: 113-155
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000785
Family HMA, heavy metal-associated domain 0.01
Further Details:      
 
Domain Number - Region: 72-108
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0023
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009173   Gene: ENSLACG00000008097   Transcript: ENSLACT00000009243
Sequence length 236
Comment pep:known_by_projection scaffold:LatCha1:JH128164.1:320527:340927:-1 gene:ENSLACG00000008097 transcript:ENSLACT00000009243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NISRCNAEEIKCLAKEIYEILNTPVCTKAEETSEPHKRRIKAQFFLNSSNKKAKTVTFQI
QGMDNVLRMMGTNCQRCKTARGDTRREISCYLHGVLFCYDHLATTPKKEQRGLCEEALLK
VKGVISFTFHMALKRCTVRISSDLQTESLAKAIAATKVLKAQQVVKNEFGEELLVVLKQE
SVSNVEKNLNLPDYLPEDESPEKDMEKAVSQNGVKQDTTKNWLNTAANFLTKTFYW
Download sequence
Identical sequences H3AHQ2
ENSLACP00000009173 ENSLACP00000009173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]