SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009398 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009398
Domain Number 1 Region: 128-394
Classification Level Classification E-value
Superfamily vWA-like 4.17e-91
Family Trunk domain of Sec23/24 0.00000056
Further Details:      
 
Domain Number 2 Region: 8-66,411-519
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.97e-63
Family beta-sandwich domain of Sec23/24 0.00045
Further Details:      
 
Domain Number 3 Region: 623-737
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.96e-46
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000129
Further Details:      
 
Domain Number 4 Region: 520-622
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 7.59e-46
Family Helical domain of Sec23/24 0.00000767
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.02e-21
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009398   Gene: ENSLACG00000008290   Transcript: ENSLACT00000009470
Sequence length 784
Comment pep:known_by_projection scaffold:LatCha1:JH126704.1:332906:378073:-1 gene:ENSLACG00000008290 transcript:ENSLACT00000009470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYQEFIQQNEDRDGVRFSWNVWPSSRLEATRMVVPLACLFTPIKERPDLPPLQYEPVL
CSRPTCRAVLNPLCQVDYRAKLWACNFCFQRNQFPPSYAGISEMSQPAELMPQFSTVEYV
VQRGPQSPLIFLYVVDTCLEEEDLQALKESLQMSLSLLPPNALVGLITFGRMVQVHELNC
EGISKSYVFRGSKDLTAKQIQEMLGLTKPAAAVQQGRPALHQEQLFISNRFLQPVHKVDM
NLTDLLGELQRDPWPVPQGKRPLRSTGIALSIAVGLLEGTFPNTGARVMLFTGGPPTQGP
GMVVGDELKTPIRSWHDIEKDNARFLKKAIKHYEGLANRAAGSGHCIDIYACALDQTGLL
EMKCCSNLTGGYMVMGDSFNTSLFKQTFQRVFSKDYNGEFRMAFGATLEVKTSRELKIAG
AIGPCVSLNSKGPCVSDNELGVGGTSQWKICGLDPNTTLAVYFEVVNQHNAPIPQGGRGA
VQYVTQYQHSNTQKRIRVNTIARNWADAQSQLQHIEAAFDQEASAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKDDPNSFRLSESFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHNFVRQDLTQSLIMIQPILYSYSFYGPPEPVLLDSSSILPDRILLMDTFFQIVI
YHGETIAQWRKAGYQDMTEYENFKQLLNAPLDDAQELLQNRFPMPRYVDTEHGGSQARFL
LSKVNPSQTHNNLYAWGQLPKGSSRMNWYLFLLQNKEDSLLKQQLFIRRTLCLIQPDFTG
LLPR
Download sequence
Identical sequences H3AIC7
ENSLACP00000009398 ENSLACP00000009398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]