SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009450 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009450
Domain Number 1 Region: 396-578
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 298-374
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000147
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009450   Gene: ENSLACG00000008333   Transcript: ENSLACT00000009522
Sequence length 581
Comment pep:known_by_projection scaffold:LatCha1:JH126836.1:336383:368015:-1 gene:ENSLACG00000008333 transcript:ENSLACT00000009522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SANSNSAVNNIFNQLFHYIIHQDIILLFMKKGIEPEYIQIVKSFEASRQQWCHVELELCQ
TQEQLLRANMENSALEVKLKHARNQVDVEMKKRHKAEAECERLERQMQLIHDILIHDGHL
SFHLSEEQKSVLASLSGRCFSSLGLTPNSRLAVIDKSCASVLSHSDISYDRTDDDLDFDS
SVVKPLKARNREKRRSSLMPAAGPPVPPKRSRPSAQQGDLPATTGTAEVAVKNPPQTIPE
EGDGVQMVTVIKAVPCEQSSRSRVVSSCTVSLIYIQTPNFTEQTTIWGGNEDFKNTPCDT
PIEPEPDPKFNYAFKTLRGSGAQQHLFVSKTVIRPETCVPCGKRIQFGKLAVKCRDCRLM
AHPKCKDRCLQLCVPTVSAASTCAGKGVLADFASPTSPMIPSLIVHCVNEIERRGLTETG
IYRIPGCERQVKELRQKFLRGKGIPSLSKADEIHVVCGLLKDFLRKLWEPLVTFRLHAAF
LEAADLPLNAGGVTVMCQLVDELPQPNRDTLAFLMLHLQRVMKSPDCKMNIINLARVFGP
TLVGHAISDPTPMTIMQDTSRQPKVVARLLSLPAKYWSEIL
Download sequence
Identical sequences H3AIH9
ENSLACP00000009450 ENSLACP00000009450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]