SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009493 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009493
Domain Number 1 Region: 1444-1508
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000748
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1013-1149
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000051
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009493   Gene: ENSLACG00000008373   Transcript: ENSLACT00000009565
Sequence length 1512
Comment pep:known_by_projection scaffold:LatCha1:JH128009.1:338981:392237:1 gene:ENSLACG00000008373 transcript:ENSLACT00000009565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPPKLAGETLIVHHIPLVHCQVSDRQCRGGVGKRANPFSQTDLGITRTTSLPERDLSQ
KDSLVYSSLVQSFCPAVAAAAPEDTTEKQKEPKGPAGIKRHNPFILGESQDFDLKAAEGS
SQASFHLHSNSYLSKPAFHLHDLASNSFHLHEVTNKVKQWSLASRPGVVEGQEASGASDN
SAKTVGAQQPRLPVSEECMELALCNCRLDSVSTLSIECGDQEWSTSPDESMKNQDDGIIN
NTSRTCSCSSLELHQGRCCSLSDQSEVVDHQMGYISDSSCNSSDGVLVNFSALYNKMNDG
QTKSNLNLANSSCDSSFCSHSEATGAFYLDLHSSPINEPKSPSCISHHLESPGKICGCGQ
GSSPTLDANCNSYHCPSESSDLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSI
TSCSEEQTKSSPGQPTEYYLFRRPEGKQESGNKAESTTRKDPQAATTGNVIEGQVYVNVS
PPNATTGRQRSRSYDRSLDKSPPPRLGSLERMLSCPVKLSEGQSGDSGRSPPKRVTSFAE
LARCRRKSGFSPPLRSSGDSSLEFSPIPELHRADPVFPEDAGNRCHSLPPMPFAHCLGFL
QHHPAPPWWCSGQQGLRAEITPALASQAARKALLHLIFLYGTLAAENARSLAHSLTHGRT
DGRTDGRGGSDDEAVFRYSKDRRPTTLPIRPFILQHSFSKQLPKPSQPNSCTSLSSTSTT
STGQTPSAAAKPAAKRNNPAGGRASAQESAKKPGPSAMRPSPLGSYSPIRSNTPFLQGTD
TSSRTPTPDRASACQPPRSHSCPLSASLLPVRPSPARDVALPGTARLEPARGEAARQEKE
TPKPTGKREHSSLPTLPSDGPTANSTSSHSEQQQRRNSAESAKPGLASSLASRSANDPVR
RLIPIGVYFQSTTLPSHIPPQPIGQSVKQLQVYYSDFFPDYFSLAEKPPAEFCLSPDANT
ESISVDLLQKKELYPCISVCLSLQCAYLGQEKNLLFKAKLGNSSVSPNVGHLILKYLCPA
IRDILGDGLKAYVLDMIIGQRRNVPWSVVEASTQLGPSTKLLHSLVCKISQYAELTNHSM
RFNAFIFGLLNIRSLEFWFNHLYTHEDIVSVHYQPSGFLALAHSVCQPLFEELLLLLQPL
SLLPFDLDLLFEHHLAEMGREQRHKKEQLRVKQDLLQSAHSTFQLMRARGGGGGSLGEQP
ASVSCERMKAVGASAGEGENRSGLGEDRMVTAAKEQRVADLRKDKQSGWWYQLMQSSQVY
IEGTAEGPKFVKWEKRKKQGVMGARMESGRKEVRSVPPRPPREGVVEGAEDCPEPEKPRG
VEKCRLSWMGSPPESVLSELKNGAEKESGTVQRWTGWQQERAGDEPADGGQGLRWGHLFG
AGVRPGRRAPADTGLDKMPKNRLPSGWLNLDKSVLQRVAQTVGGGRRRQAQADQEDLKKK
KKKTMKASPMWKGEVKALCHHIATEEGQLSFNKGDVLRIVSKVDPDWLLCSVGSERGLVP
IMYVTHPEDKDY
Download sequence
Identical sequences H3AIM2
ENSLACP00000009493 ENSLACP00000009493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]