SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009932 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009932
Domain Number 1 Region: 165-197
Classification Level Classification E-value
Superfamily WW domain 0.000000000134
Family WW domain 0.0012
Further Details:      
 
Domain Number 2 Region: 115-146
Classification Level Classification E-value
Superfamily WW domain 0.000000000623
Family WW domain 0.0012
Further Details:      
 
Domain Number 3 Region: 9-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000019
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009932   Gene: ENSLACG00000008754   Transcript: ENSLACT00000010008
Sequence length 390
Comment pep:known_by_projection scaffold:LatCha1:JH127493.1:367945:399374:1 gene:ENSLACG00000008754 transcript:ENSLACT00000010008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNKPSIDFHEKGKNHKENVAKKISEIKKKSMDKAKEEAK
KSKEFAAMEEAALRAYEKDLKRLGEAGLVSTTPTTAQSQKEQKKVSQKKTVQTSSWVEGV
SPEGYTYYYNTETEESQWERPEGFLESSKTSEQNGSQKEKLTSSAWVEGVSPDGYTYYYN
IKTGESRWEKPEDFTARSEDVPRDESSQDSSQSEEPLSSESRESEPIGEAEAEAEEEEEK
EENEEKGADEKEAQKPKISFRKNNSEEVKTDRKSENESETKEEENITAQEQSSSEILEKR
SELPKKVNPYGVWEEVKLEEPSEQVDLQLPNVEFDYPTVPVAEIPSEPKVKFKEKTITSL
GDGAEGGAAFRKRKLENPKGRNLRQRGNDE
Download sequence
Identical sequences H3AJW1
XP_006003544.1.90931 ENSLACP00000009932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]