SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010239 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010239
Domain Number 1 Region: 1478-1547
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000121
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010239   Gene: ENSLACG00000009020   Transcript: ENSLACT00000010317
Sequence length 1737
Comment pep:known_by_projection scaffold:LatCha1:JH127415.1:387598:447569:-1 gene:ENSLACG00000009020 transcript:ENSLACT00000010317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISEDKI
FADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKALEKGE
TLPTEARFDSNCITPGTAFMARLHNHLKYFVNMKISNDKAWHGVAVYLSGHETPGEGEHK
IMEFIRAEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKSQKRVS
APEETTFHLLHLSLMREYIEYEFSPVKDKICFEFDIERIINDWILMGFLVGNDFIPHLPH
LHINHDALPLLYRTYMEVLPKLGGYINENGNLNLKRFEKYLEKLSAFDHEHFSEIFVDLK
WFESKVGNKYLNEAAGTAAEEVRSHKQKKQKFQDDLICLAAFDKDVDGAPSKDLVDDEAE
DDDLFETEFRQYKRMYYMTKMGVEVVTDEFLAEQAECYVQAIQWILHYYYHGVQSWSWYY
PYHYAPYLSDIRKISKLKLKFDLGKPFLPFEQLLAVLPAASKDLLPKCYQHLMISEDSPI
IEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMAPCNAFLIEEEKSRNRHSECVLY
WYDKDTDFKYLFPGPEMFPSIERCYARFKSIPMDAWHVDLAYHPNKINKSALYFCGFPTL
KHIKHKFHLKKAGVQVFQQSSRGENLMIEIIPDDSEEEPEIENVANLVLGKSVFVNWPHL
EEARVVAVSDGETKLFLEEQTGVQKLYTGREPPPVKVVYLGDKDQNTWLKEVQGIAEYYQ
KRKGVIINETSVLVYAQLLTGRRYVASQNGEVHLEKQWSKQILPFVYQTIVKDITAFNSS
FSHFKTLNDFFPTGSTVFMLGTPYYGCMGEVQDSFDVSREGRVRVVFSIPCEPQLDTLIR
NQHKYSIKYNPGYVLASRLGVTGYLVSRFTGSIFIGRGSKNNPHGEQKANVGLNLKFNKK
NEEVPGYTKKVANEWMYSSSVEQLLAEYLERFPELFTHVAKNSQEDVFFEDDIWPGEDEN
GAEKVQEIVMWLKTHPVSSSSRASCDLHILDAAIVEKLEEEIEKCKQRKSNKKVRVTVKP
HLVYRPLEQQHGVIPDKEADFYLFDRVVNVRDSFSVPLGLRGTIIGIKGAEREADILYEV
LFDEEFPGGLTIRCSPARGYRLPVCALINISHGNRLESGAQKLTAVVKPQPAVVSQNNSF
SNTAVSQFSAQKVQLGGLNHSPRSPFVPTRGHTKQDDEFCSVWHSLQGSGKPQNWQEKAA
FLPQGNKYGANPNYQSQKTGYADNSVKVQSSRQTSQQRYKQDHQNQQGFSKKINKIYPVL
DFSATVGNVKILKRNEDPPAFSKKQPSTEGSTTDAKVSAEFENLIASLNISKGNETQTSS
LSKEEVTSEEHLSPQSFAMKGTQMLKEILKINGPDEVQTHKDVKTSCEETIPSTAKNWSR
GHHSHRQTKLLAAHINKPQISGNVQGPETLHQPFGAQQPMLPTPVSELSRICSSVGMVQP
EFSFLRTPQGMTVCQVKLSNGLLVHGPQCRSENEAKEKAALFALQRLSSIGSSLPLPPPL
FPNYPQIRAAVPPGPIPPVFSQHTANLMPHSSHGYGPLSWSAPVPVHSQPYYQNPYPMNM
PPGRGAPLNMSNQFIPLQVTKKRAFSKKNFDNKDSCDSSQASQNEVSVFSEEPNKTSQTR
LSTSINSHEASPHTSEDKVVVQNSAPSNRKSASASSSSGRRKPRKLAVNFGAPKSNQ
Download sequence
Identical sequences H3AKR8
ENSLACP00000010239 ENSLACP00000010239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]