SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010403 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010403
Domain Number 1 Region: 124-236
Classification Level Classification E-value
Superfamily SH2 domain 2.28e-21
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0066
Further Details:      
 
Domain Number 3 Region: 71-155
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000597
Family SH3-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010403   Gene: ENSLACG00000009165   Transcript: ENSLACT00000010482
Sequence length 245
Comment pep:novel scaffold:LatCha1:JH127519.1:399563:417030:-1 gene:ENSLACG00000009165 transcript:ENSLACT00000010482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSNIFPDNSMANGHDFQMYSFEDTASCKACQMLLRGTFFQGYRCTRCKVPAHKECLGRVP
LCGKQTSETQNKSNRSTPNRNTDQGLPKMEVSQEYYGVPPPPVAYGPPLRLCLGDIIEIT
KAEVEQQWWEGRNTATNEVGWFPRTRVKPYLCVSNPPVPDLSSFPWYAGPMERGEAQSLL
NNRSDGTYLVRQRVKDCGEYAISIKFNLEVKHIKVTTADGLYRVTDKKAFKGSLQHLPFP
KLHIY
Download sequence
Identical sequences H3AL82
ENSLACP00000010403 ENSLACP00000010403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]