SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010473 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010473
Domain Number 1 Region: 1-415,595-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-199
Family Motor proteins 0.0000000665
Further Details:      
 
Domain Number 2 Region: 1865-2054
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.000077
Further Details:      
 
Domain Number 3 Region: 1804-1858
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0071
Further Details:      
 
Domain Number 4 Region: 792-841
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000023
Family Motor proteins 0.023
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000010473
Domain Number - Region: 842-887
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000113
Family Motor proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010473   Gene: ENSLACG00000009226   Transcript: ENSLACT00000010552
Sequence length 2366
Comment pep:known_by_projection scaffold:LatCha1:JH127194.1:404444:692881:-1 gene:ENSLACG00000009226 transcript:ENSLACT00000010552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAFGNAKTAHNNNSSRFGKFIQVNYQETGTVRGAYVEKYLLEKSRLVYQEHNERNYHVFY
YLLAGASEEERTAFHLKEPEEYHYLNQMTKKPLRPSWDEFTHYYESEPDCFTVEGEDLKH
DFERLQLAMEMVGFLPITRRQIFSLLSAILHLGNIRYKKKTYRDDSIDICNPEVLPIVSD
LLEVKEEMLFEALTTRKTVTVGERLIVPYRLAEAVTVRDSMAKSLYSALFDWIVFRINHA
LLNTRDLEENTKILSIGVLDIFGFEDYESNSFEQFCINFANERLQHYFNQHIFKLEQEEY
RAEGISWYNIEYIDNTGCINLISKKPTGLLHLLDEECNFPQATNQTLLDKFKRQHEGNSY
IEFPAVMEPAFIIKHYAGKVKYGVKDFREKNTDHMRPDIVALLRSSRNAFICGLIGIDPV
AVFRWAVLRAFFRGMVAFREAGKRFVEKKTVASKGHDDAVPCAVLKSVDSFSFLHHPVHQ
RSLEILQRCKEEKYSITRKSPRTPLSDLQGANTINEKTPRENFGMSWNGRTGVRQSRLST
NSSLLEEDGIFVNSTSSKLLERAHGILMRNKNYKVKPSLPKHLLDVKSLKYFASLTLHDR
ITKSLLHLHKKKKPPSISAQFQASLNKLMETLGQAEPYFVKCIRSNAEKLSLRFNDNLVL
RQLRYTGMLETVRIRQSGYSIKYTFQDFVDHFHVLLPWDTLPSKWNIQDFLKAAELDPNN
YQIGKTMVFMKERERQQLQDLLHKEVLRRITLLQHWVRAFLERRHFMNLKQAATIIQKCW
RSYKVRQDAEEEQAQALIMNSAATSIQSAWRGYWQRKRFLQMREAAFVIQSCWREYQQRR
EEAAMLVQAAWRGYQDRKAYWAQKDSIILLQTLWRGFSARQRFRALKEQKLKEGQLSNGL
DVKPENLNVENSSDPTKWEDGSFDERERAIRERRSVEELNKANVGWKDTPTNLQSSSDER
GTNKEVVVRERPKSLEDPDQKKVFRAKRESRRMRELEQEKFSLELLKVRSTGGSTTPPTE
EHRWSTELVTEGLHSPQGTPDSESSRGSFEVLACEDNQKLKLSSTGGEDEAGGPLAAPEL
QDSFLSNPKLDPLSLFSSSLDINCIVPSGPSILASSGFTSSPPAIERPADDNLSTGPRVT
VKLPFTSSTLQTFYMPRLDNIAKSAQPAGDVLALGPLSTEDTGTNKEAVTTDSQTASEKT
DSKLEESPMAGVEGDTKISILEHREKQKAEQQRSAQRQNEKEMMEQIRQQKEILKLQRQL
FEQDERNLFEKHREEALQRIEQCRHNDSRQADRPQSLLILHTQDAGDPADLSPTAVELQL
ISGPDASSTERNPSTAKDRPVSLFLDRREWPALSLPETTKIDGWSPKLTRESRDSPATAG
TRNERPRQPRLQSQGADGLAGERATAIFFSPKDNKVLCVCVRGAQPCAKNQEGPIFNTAN
SAPGFNQVPRPAHKKKARMARTRSDFLTRCSYAGGEGDTEEDDFDDIIEPPLSPKQSSHP
SLEPALRLACYSDSEMMLQQLTTAEGLRKHHKTLSQGEIGKRDIQRKNSATDGRPLRGKM
RFWGKGKQGEKKVSREKLATQVEIQELPTDQETQTMDTSPTLQTSEGADLGQRHLTPPRS
PDLAADRGKEFKENKEPSPKVKRKRSVKISNIALEPAQWQNDSLQIISSAADFKSMNEFL
QKKITDLDTEDSKKDTMVDVVFKKALKEFRMNIFNSYSTALALDDGKSIRYKDLYALFEQ
ILEKTMRQEQRDWSESPVKVWVNTFKVFLDEFMTEYKAPDNTFGKITKTERKKRRKKDTD
VGEEHNGHIFKSTQYSIPTYCEFCSSLIWMMERAYVCKLCKYACHKKCCLKTITKCSKKF
DPELSSRQFGVELSRLTNDERSVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQG
LDTDINCVNLDEYNIHVIASVFKQWLRDLPNPLMTFELYDEFLRAMGLQERKEVIRGVYS
VIDQLSRTHLSTLERLIFHLVSISLQEETNRMSANALAIVFAPCILRCPDTTDPLLSVQD
IGKTTSCVELIIIEQTNKYKARLKDINSLEFAENKAKSRLSLIRRSMKPVLIAVRFMSIT
RTSVPGKGRLRRGNYPSPTSQVAVRLPSVSDVPEETTSAEESMELDLSEQQQVAMQQEER
VLTEQIENLQKEKEELTYEMLALEPRASDDETLESEASIGTADSSETLNLDSEGAVSDRS
AGLGRHPKPDSAIKVRRPLRKQPDSVDSTDSSISSLPSSSSLGVPQGHGRRFRFRSKSPL
SGFYKDSTPEGDAASPGQIRGQEERSLFISRGTFNPEKGKQKLKTVKSPQKPRDPPDGAA
GRKRNPDTDYNSSQQLVVYGSNEFMV
Download sequence
Identical sequences H3ALF2
ENSLACP00000010473 ENSLACP00000010473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]