SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010549 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010549
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 148-216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010549   Gene: ENSLACG00000009295   Transcript: ENSLACT00000010628
Sequence length 274
Comment pep:known_by_projection scaffold:LatCha1:JH128413.1:409550:410374:1 gene:ENSLACG00000009295 transcript:ENSLACT00000010628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLAYTEINADRISCVENCFGASGQPLAKPGRVLVGEGILTKVCRREPKPKVFFLFND
ILVYGSIVINKKKYNSQHIIPLEHVTLENLPDTDHLKNVWIIKTVKKSFIVSAASSTEKM
EWISHTERMVKQLLEKIGKEPTTEHAAVWVPDKATDICMRCTKSKFSALNRRHHCRKCGF
VVCGACSRNRFVLPMISPNPLRVCGLCYKHLEAVRRKEAEEERQQLEAYYSAMPTYEASS
DEDSDEKATDEKAEEWPGQEAFYSSNTTWSSFHS
Download sequence
Identical sequences H3ALM8
XP_006008746.1.90931 ENSLACP00000010549 ENSLACP00000010549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]