SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010560 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010560
Domain Number 1 Region: 57-217
Classification Level Classification E-value
Superfamily RNase III domain-like 0.00000000000018
Family RNase III catalytic domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 224-302
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000959
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010560   Gene: ENSLACG00000009306   Transcript: ENSLACT00000010639
Sequence length 325
Comment pep:known_by_projection scaffold:LatCha1:JH126709.1:408160:416264:-1 gene:ENSLACG00000009306 transcript:ENSLACT00000010639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLLVSRVLSSQIYRNVLFTQTREKKRWMKVYMFLMERKRKLEGPPAPKPRSHQPNWD
YHAEVQAFGHRLTETFFLDLLKTAFVNSCYIKFEESKRLELGLDKDKVALNLKDNQELCE
QGASFSSMYLTDFFKQTYPSMPSEGVAAIVNYLLCQEVVCHVARNLGVEDLTLSAEFPVP
QDVLQKTFFALIGALLQSSGPQKTGIFIKDFLTTQLIGKDLFELWNVVNPMGLLVEELTK
KNIPAPEPRLTRESGASTVLPLYFVGLYCDKTLIAEGPGETLLAAEEEAARVALRKVFGY
THNRQPWDFSKPREEQEAKKAIGSS
Download sequence
Identical sequences H3ALN9
ENSLACP00000010560 ENSLACP00000010560 XP_005993091.1.90931 XP_014342160.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]