SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010569 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010569
Domain Number 1 Region: 344-610
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.37e-60
Family Protein kinases, catalytic subunit 0.00000000285
Further Details:      
 
Domain Number 2 Region: 58-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-23
Family Ras-binding domain, RBD 0.0001
Further Details:      
 
Domain Number 3 Region: 132-185
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000152
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010569   Gene: ENSLACG00000009313   Transcript: ENSLACT00000010648
Sequence length 649
Comment pep:known_by_projection scaffold:LatCha1:JH127547.1:410979:427789:-1 gene:ENSLACG00000009313 transcript:ENSLACT00000010648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRFHDSSGSLSNGLSPPLSAHSVETATASAMESSASQHSSQPSPEASPADTQKTSGTIR
VYLPNKQRTVVNVRAGMTMYDVLDKALKLRGLNQDCCAVYRLIDGVLIRKTLTDWETDIS
PLVGEELLVEVLDTVPLAMHSFARKTFFNLTFCDFCHKFLFHGFRCQICGYKFHQHCSSK
VPTVCIDMDTLNKRIISYSGAHDEQSFLDLPSPFSMSQIMEPLTPQPAGARNKHLALPAF
TFPCSTGDGQPLQRQRSTSTPNVHMISTTAPVDSRIIEKGLKSYSIGVDSIPRMSTSPPN
TVSPGKKPPHQKSPSEPHKERKVSMLDDKKKMKVLGYRDSGYYWEVHHGEVTMSKRIGSG
SFGTVFRGKWHGDVAVKILKVTSPTAEQIQAFKNEMQVLRKTRHVNILLFMGYMTKPNFA
IITQWCEGSSLYRHLHVLETQFDMIQLIDIARQTAQGMDFCYMLGPQARDTKHNYIFLHE
GLTVKIGDFGLATVKTRWSGSQQMEQPSGSILWMAPEVIRMQDSNPYSFQSDVYGYGVVL
YELMAMTLPYSNISNRDQIIFMVGRGYLTPDISKVKSNCPKAMKRLLMNCLKFKKEERPL
FPQILATIESQQRALPKLERSASEPSLHRAVHSEDLNPLILSTTRLVVH
Download sequence
Identical sequences H3ALP8
ENSLACP00000010569 ENSLACP00000010569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]