SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010765 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010765
Domain Number 1 Region: 1406-1633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-39
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 454-566
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-31
Family Cadherin 0.00088
Further Details:      
 
Domain Number 3 Region: 559-664
Classification Level Classification E-value
Superfamily Cadherin-like 4e-28
Family Cadherin 0.00072
Further Details:      
 
Domain Number 4 Region: 870-982
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-28
Family Cadherin 0.0006
Further Details:      
 
Domain Number 5 Region: 241-344
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 761-868
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 1656-1840
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-26
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 8 Region: 346-452
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 975-1076
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 664-765
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 2456-2712
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000915
Family Rhodopsin-like 0.025
Further Details:      
 
Domain Number 12 Region: 1346-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000936
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1078-1180
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000136
Family Cadherin 0.0097
Further Details:      
 
Domain Number 14 Region: 1986-2026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000222
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000010765
Domain Number - Region: 2029-2088
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00012
Family Hormone receptor domain 0.0056
Further Details:      
 
Domain Number - Region: 1855-1890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1897-1933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000341
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1325-1350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010765   Gene: ENSLACG00000009478   Transcript: ENSLACT00000010845
Sequence length 2955
Comment pep:known_by_projection scaffold:LatCha1:JH127550.1:423958:771418:1 gene:ENSLACG00000009478 transcript:ENSLACT00000010845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAYAWILISFLCKLPMVGCFDLHLSENLEAGDLLANLSLGPSWIYAIDRNLTPQFVRD
FLKIDSRKGTLTLSRRLDCSLLVRNPSQLYFHIGSQISEKFILLSRFNVYVHGQDCFIKY
KRKSRTGEPDLYINYSVKLKADHCFSAGEVLLNVNEIITAFVHSNGEIVSKKERCLKRRG
EVTQVEFLCSPKLESGQGTRLDQVFIRVKLKYQPSRGVSNVGKGENTVVRSARRRRSLNS
SPQFKSPNYQVSVPENEPAGTPVIALTAQDPDQGEAGRVYYSIEALFDSRSNDFFQIDPE
TGSVSTTQALDRETKDTHVFRVAATDNGSPKRSATCFLTVTVSDRNDHVPVFEQSEYRER
IRENVEIGYEVLTIRATDGDAPSNANMLYKILNGDGPNSAFDIDLRSGVVRTRIQVDREL
LSEYQLIVEANDQGKDPGPKSATATVHITVEDENDNYPQFSEKRYVVQVPENVAMNTKIL
QVHATDRDQGNNALIHYSIVNGNIKGQFYIDSITGNIDVINPLDFEMNREYSLRIKAQDG
GRPPLINSTGIVLVQVVDINDNAPIFVSTPFQSTVLENVPLGYSVIHIQAIDADSGDNAR
LEYKLTDTTPGFPFTINNNTGWITVSTELDRETTASYEFGVEARDQGKPAMTSSASISIN
VLDVNDNDPTFTEKMYHLRLNEDAAVGSSVVTVKATDKDANSVVTYQISSGNTRNRFAIT
SQSGGGLITLALPLDYKQERQYVLTVTASDGTRFDTVQVFINVTDANTHRPVFQSSHYPV
SIHEDQPIGTTVVVIGATDEDTGENARITYIMEDNIPQFKIDPDTGAITTQMELDYEDQA
SYTLAITARDNGIPQKSDTTYVEILILDDNDNAPVFVNDRYRGSVFEDVPLHTSVVQISA
TDRDASLNGRVTYTFQGGDDGDGDFHIEQTSGIIRTLKKLDRENVPVYNLKAYAIDKGVP
PLKASVDIQITVNDINDNPPVFEKDEFDIYVDENSLVGSTVARITATDPDEGTNAEIMYQ
IVEGNIPEVFELGLFNGDLIALTDLDYETNTEYLIVVQATSAPLVSRATVHIRLVDKNDN
DPVLKDFEIIFNNYITNKSNSFPSGIIGKIPAYDPDVSDSLSYSFVEGNELNLLILDQFT
GELKLSRALDNNRPLEANMKVSVSDGLHSVTAQCTLRVTIITDDMLTNSITVRLENMSQE
KFLSPLLSLFVEGVAAVLSTTRDGIFVFNIQNDTDVSANILNVTFSALLPGGIRNRFFPS
EDLQEQIYLNRTLLTMISTQRVLPFDDNICLREPCENYMKCVSVLKFDSSAPFISSNTVL
FRPIHPINGLRCRCPPGFTGDYCETEIDLCYSNPCGNNGLCRSREGGYTCECHEDFTGEH
CEVNARSGRCAPGVCRNGGMCINLLIGGFKCECPSGAFEMPYCEMTTRSFPPQSFITFKG
LRQRFHFTVSLMFATRERNALLLYNGRFNEKHDFIALEIIDEQIQLTFSAGEASTTVATF
VTGGVSDGQWHSVQLHYYNKPNIGRLGIPHGPSGEKVAVVTVDDCDTAVAVRFGNQIGNY
TCAAQGTQTGPKKSLDLTGPLLLGGVPNLPEDFPVQNREFVGCMRNLTIDSKPIDLASFI
ANNGTIPGCAAKKNFCDTNRCQNGGTCVNKWNTYGCECPLHYGGKNCEQVMQYPQHYSGH
SMVSWDNLDITISIPWYVALMFRTRKANGMLIQANAGASSKIKILVIDSSLQLDVHSGKS
HVASMKLTQVRVNDGEWHHLLIEIKNTKGENGIKYLAEMSLDYGIHMNTVEIGNELPGLK
LKTIYVGGLPEGNNSVQQGFNGCMQGLRMGETSSNSASLNMSKATKTRVEEGCEVNDPCD
SAFCPINSHCSDDWNSYSCICDPGYFGKGCVDVCRLNPCEHVSACVRKPSSSHGYTCECG
QNYYGQYCENKIDLPCPRGWWGNPICGPCNCDTSKGFDPDCDKTTGECQCKANYYRPPGS
DACYPCDCFPTGSHARTCDAETGQCPCKAGVIGQQCNRCDNPFAEVTNSGCEVIYEECPK
AFEAGTWWPKTKFGRPAAVPCPKGSTGNAVRHCNEEKGWLPPELFNCTTHTFAELKTLNE
KLHRNETKLDGNKSNQIAKMLHNATQHTKSFYGNDVKTAYQLLLRVLQYESRQQGFDLAA
TRDVEFNENIIHAGSAILDPSNKEHWEQIQRTEGGTAHLLKHYEEYANNVAQNMRKTYMK
PFIIVAPNIIIAVDVLDKSNFSGAKVPRFEDIHEEYPKDLESSVLFPKALFNFPDDKSKA
VLVKPTNKPSGLKNPSRHQKRSSGTNGAPSKRKKRNADSVEEYAVAVVIIYRSLGQLLPE
QYDPDRRSLRVPTRPIINTPIVSTMVHSEGEPLPSQLEKPIILEYNMLETEERTKPVCVF
WNHSIMTGGTGGWSSKGCELLSRNQTHVTCQCNHMTSFAVLMDISKRENGEVLPLKIVTY
ATISISLIALLVTFILLVLIRTLRSNLHSIHKNLVAALFFSELIFLIGINQTDNPFVCTV
IAILLHYFYMCTFAWMFVEGLHIYRMLTELRNINSGHMRFYYVIGWGIPAIITGLAVGLD
PQGYGNPDFCWLSVYDTLIWSFAGPIVVVVIVNIVIFILAAKASCGRRHRTFEKDGAISG
LKTAFLLLALICTTWLLGLMAVNSDVMTFHYLFAIFSCLQGLFIFFFHCIFNKDVRNYMK
NVFTGKKVPTDESVMTRTSLLTRSLNCNNTYIEEPNMYRTAIGESTASLESTVRSAKSHN
SYLAYILRDEAAQKLSLSSSHAKAGHTEVDSLIFHRKPANADDHDSDSDSELSLDEHSSS
YASSHSSDSEEESKPKWNPKTPKNNEKLPMHSTPKAESVPNHVKPYWPTECTTASDSEDP
GGSEKLKVETKVNVELHQENKLNHIGELPQDKENNVQQKDNTAAPQQNNHPPEQRKGKVL
DDWRRKGESSLKRHY
Download sequence
Identical sequences H3AM94
ENSLACP00000010765 ENSLACP00000010765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]