SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010801 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010801
Domain Number 1 Region: 388-636
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000549
Family Tricorn protease domain 2 0.033
Further Details:      
 
Domain Number 2 Region: 169-217
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000987
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000010801
Domain Number - Region: 299-362
Classification Level Classification E-value
Superfamily PH domain-like 0.000524
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010801   Gene: ENSLACG00000009509   Transcript: ENSLACT00000010881
Sequence length 881
Comment pep:known_by_projection scaffold:LatCha1:JH127385.1:426865:532842:1 gene:ENSLACG00000009509 transcript:ENSLACT00000010881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARLELQSALDAEIRAKQVIQDELNKVKAASISTECKLQEADKRNLELLADIEKLKKET
EDLKSEKGVKHQDSQNSFLAFLNAPTSTLDQFEIDSVDNFNLSTPSRDEEAKSQIHSRSR
SPSTASEIEPIEVADHPPRSLQTPTMRSGYSGSTLSAPKDTPPVRIRQGFRSPSFCNRCS
PTCVYILVLCVCVAVCGFSCHVTCADKAPAVCPIPPDQTKGPLGIDPQKGIGTAYEGHVR
VSPTGEKGQPLTAMDVLVKINSFLFFLPVASLIADMNESLVSLSLRDEEFSVCSVLASDV
IHANRKDIPCIFRVTASQLSACSSKCSILLLADNESEKNKWVGLLNELHRILKKNKLKDR
SVYLPKEAYDSTLPLIKTTQSATIIGHEQIALGNEEGLFVVHVTKDEIIRVGDNKKVHHI
ELIPHEQLLAVISGRNRHVRLFPMAALDGREMDFYKLAETKGCQTLVSGQVRHGALTCLC
VAMKRQVLCYELNQSKTRHKKIKEIQVPGNVQWMGIFSERLCVGYQSGFARYPLHGEGNP
QSLLHPDDHSLAFLSHHPADAICAVEISSKEYLLCFSSVGIYIDCQGRRSRQQELMWPAV
PASCCYNAPFLSVYSENSVDIFDVNTMEWIQTVPLKKVRPLNTEGSLNLLGLETIRLIYF
KNKMAEGDELVVPETSDNSRKQMVRNINNKRRFSFRVPEEERMQQRREMLRDPEMRNKLI
SNPTNFNHIVHMGPGDGIQILKDLPMNLRPQESRTMFSGSVSIPSITKSRAEPGRSLSAS
SGLGSRPSAQNGSALRREFSGGGYGVKRQPMTSPSDGSLSSGGLDQGNDVPTREFEREDS
DSPRHSTASNSSNLSSPPSPASPHKTKSLSLESTDRLGWDT
Download sequence
Identical sequences H3AMD0
ENSLACP00000010801 ENSLACP00000010801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]