SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011240 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011240
Domain Number 1 Region: 52-61,110-478
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.49e-77
Family Formin homology 2 domain (FH2 domain) 0.0000944
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000011240
Domain Number - Region: 50-88
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0418
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011240   Gene: ENSLACG00000009888   Transcript: ENSLACT00000011324
Sequence length 479
Comment pep:novel scaffold:LatCha1:JH127456.1:456398:465912:1 gene:ENSLACG00000009888 transcript:ENSLACT00000011324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKDLDQIWDLLVKNVKELKLKAMDFSDLWDEDDSALVQNTNVSCGGAVPSPPPPPPPPPP
PPFCSPSVSQSPPPAPPLPLPQKGSPMNLCPLASPKVPGSTSAKKKTIKLFWNEIHNLPA
LPKFSRFGQETIWASLEPINVDTNKLEYLFESRSKDLQLIKNKSGQKKELIVLEVKRSNV
INIGLTTLPPTHIIRAAILSFDECVIQKEEVEKLLSLMPMEKEVEKIREAQLKDPYLPLG
TAEQFLFSLSSIPDLPTRLRLWAFKLDYDNKEREIAEPLFNLKLAMEQLADNKTFRCILA
TLLAIGNFLNGCNAKGFELSYLEKVPQVKDTVHHKTLIYHTCHILLDNFPDTTDLYSQIT
AVTKAAKVDYVQVHNNLIELEANYKASCDYVKVIFRHESYGSLKSRLSAFLKDCAQRISI
LKDVHRRVLNRFHSCLLFFGYPGSAIRKMSVNKFFKLISDFALEIHTMRVQILQWKEKQ
Download sequence
Identical sequences H3ANL9
ENSLACP00000011240 ENSLACP00000011240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]