SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011787 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011787
Domain Number 1 Region: 12-307
Classification Level Classification E-value
Superfamily Terpenoid synthases 7.2e-68
Family Isoprenyl diphosphate synthases 0.00000000402
Further Details:      
 
Domain Number 2 Region: 745-798
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000551
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 382-551
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000615
Family RUN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011787   Gene: ENSLACG00000010377   Transcript: ENSLACT00000011877
Sequence length 800
Comment pep:known_by_projection scaffold:LatCha1:JH127279.1:498021:576343:-1 gene:ENSLACG00000010377 transcript:ENSLACT00000011877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSSEKTLQAQYDAQEFERMFAQIVKDLTERDLHHAEIGDAVARLKQVIEYNSPGGKRNR
GLSVVASFRELARPDQQNADNHQRALVVGWCVELLQAFFLVADDIMDASITRRGQPCWYK
KEGVGLDAINDSFLLEASIYRLLKKYCKGQPYYFHLLELFLEASYQTELGQALDLMTAPP
NEIDLSRFTESRYKAIVKYKTAFYSFYLPVAAAMYMAGIEKEAEHNNAKTILLEMGEFFQ
IQENYGKNEQEKVAKVKALYEDLDLKVAYREYEEQSYQRLMALINRHAGNLSKDVFMLFA
QKIYKRQNSCSDFESDATTNSICSKELPLSGQSNVPRSIFDFKLGSWHSLPLSSGWMKGR
IWMGSREWTLSQQAVPLVCLQQKRGLLNAVSSSVDKIVSHFSTTRNLVQKAQLGDSRISP
EVGHLVLQGLCPALYAIVGDELKPYQNDLIVGRRKNSPWHVVEASVKPGPSTKSLYSLYC
KIHQLSQLSNSKTRFNAFIFGLLNVKQLDFWISHLKKCTDVLAIHYSPTAFLSLTEKPFL
HLFEELLLLLQPLSVFTFSLDLLFEYHHHFQVDFEKALANGSLQTTLHQVRQWGDKLANT
LMRNGSQPVKASKEAATGKKPASWWEQLSETSRVYVSPKQEGFLFAKWIRAKSPTSKEGT
HSEAYPRRSPATEEPKMWLGRLFGANSPSSKGSPDDPEMAYRPRRPSSWLAPNVNVFDFM
HKGSASEKEKSSPPQPTGCALTADPAVKALCDHASAEEEHLSFKKGDVLQVLSSVDEDWI
RCCHGDEVGLVPIGYTSIIL
Download sequence
Identical sequences H3AQ66
ENSLACP00000011787 ENSLACP00000011787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]