SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012113 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012113
Domain Number 1 Region: 694-755
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000109
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 2 Region: 871-963
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000507
Family PLC-like (P variant) 0.087
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000012113
Domain Number - Region: 1147-1207,1284-1595
Classification Level Classification E-value
Superfamily ARM repeat 0.0529
Family Armadillo repeat 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012113   Gene: ENSLACG00000010665   Transcript: ENSLACT00000012205
Sequence length 1639
Comment pep:known_by_projection scaffold:LatCha1:JH127881.1:523604:652357:1 gene:ENSLACG00000010665 transcript:ENSLACT00000012205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVVDHILKELVGISQIQEEIAELRHHLSSIKGSVDEVSSCVDTVLNEIEGMRVGFRSSHG
GSSLDLCPNSQEGSSVLYFHNVPEEDSENTAELIQRFLFQCNCFNGAKRSPDIRGACRQE
IAEKESDTAPPRPILVEFVCHEDCDLILRNATLLQVVGVDVSATHERPSSQSGQRLLQET
KSVETLLGFNERGFQLSSASLCDDQPSDASDGVECIAKLETSDGSAHGFTELYSNRNKLT
RSDTTTAEKHLCFVSEAEVDHSCLVEEQPELSLDCLLLIGHLQDACGYVSAVGHPLLRPQ
SSHSSQKCTEGDTCAPDLCEEADVSVSRSNGSLRVGQTPLERQCGELNSESKMEADAQQI
GGLDGMAEKQLNCMSLERPFEKSCAAAGSQEQLDHSPRHRALSPHQDEGELTDLGFNTQK
LGKALLHFKSALKDAFKLESRDSPSPEAEVALPVFEVGVCTDAEELAPSEKPSGLAECRT
STPKLKVQEISVSSNASTAVPHGSPRSLVSCTSTSDSCGDQLMVSSEQGLDDSFSSVLEV
SQGATSSESDATLATSMKLEQVCANTIFLNKCISNFRTVLKEKRETQRRLLKSLTLSRSH
FSVTEVPKPRRADSKARLGDDGDPSKSPWLKGGAGGGLYGIDSMPDLRKKKPIPLVSDLS
LVQSRKAGITSAMATRTSLKDEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCY
ECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQXRVQRESCVCERERRESCVCERE
ESRVCVRERKREESRVCVRERGESRVCEREESAECRVCVRESTERVVCVRGESTESYLGS
PAIFFYSKTDKSVVKRWSYLFKTPSKFFFFFFFFFECHNSSDRIKVRVWDEDDDIKSRVK
QRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQINVEIKGEEKVAP
YHIQYTCLHENLFHHLTDVQGGGVVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGIESI
YQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKDRFV
KLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQ
VVKDCVKACLNSTYEYIFNNCYELYSREYQTDPDLPPEEQGPSIKNLDFWPKLITLIVSI
IEEDKNSYTPVLNQFPQELSVGKVSAEVMWNLFSQDMKYAMEEHEKHRLCKSADYMNLHF
KVKWLYNEYIRDLPAFKGSVPEYPAWFEQFVMQWLDENEEVSLEFLHGALERDKKDGFQQ
TSEHALFSCSVVDVFTQLNQSFEIIKKLECPDPTIVAHYMRRFAKTISKVLLQYAGILSN
SFQFYCSKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDVEASDTLKELQVKLNNVLDEL
STVFGNSFQPRIDECMKQMSDILCQVKGTGNVAATARNTVAQDADNVLRPLMDFLDGNLT
LFAKVCEKTVLKRVLKELWRIVMNTMEKTIVLPPLTDQTGTQLIFTAAKELGQLSKLKDH
MVREEARSLTPKQCAIMDLALDTIKQYFHAGGNGLKKTFLEKSADLQSLRYALSLYTQTT
DTLIKTFVQTQTTQGRSGK
Download sequence
Identical sequences H3AR42
ENSLACP00000012113 ENSLACP00000012113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]