SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012766 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000012766
Domain Number - Region: 12-80
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000107
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 
Domain Number - Region: 74-198
Classification Level Classification E-value
Superfamily RUN domain-like 0.00353
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012766   Gene: ENSLACG00000011244   Transcript: ENSLACT00000012860
Sequence length 204
Comment pep:known_by_projection scaffold:LatCha1:JH126578.1:584275:592622:-1 gene:ENSLACG00000011244 transcript:ENSLACT00000012860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASALQAAQQQQPQPQPQPQPQPQPQPSQPPSALPGQAAAQSQLQGAALQQQQQQQQQQ
DFDPVHRFKMLIPQLKESLQNVMKIAAQNLVQNTNIDNGQKASDATVQRFDKSLEEFYAL
CDQLELCLRLSYECLSQSFDSAKHSPNLVPTATKPDTVQTESLSYTQYLSMIKSQISSAK
DIHNALLECSNKITGKGQTQGILG
Download sequence
Identical sequences H3ASZ5
ENSLACP00000012766 XP_005987863.1.90931 ENSLACP00000012766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]