SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012774 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012774
Domain Number 1 Region: 448-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.6e-62
Family Protein kinases, catalytic subunit 0.000000000747
Further Details:      
 
Domain Number 2 Region: 112-184
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 184-237
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012774   Gene: ENSLACG00000011252   Transcript: ENSLACT00000012868
Sequence length 768
Comment pep:known_by_projection scaffold:LatCha1:JH127240.1:584960:658014:1 gene:ENSLACG00000011252 transcript:ENSLACT00000012868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWNIKQMIKLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDNLQRREQQLLESMGNG
TEASSPNPATTDLAATASIPPTYSLALAPMTLGVLSNLSDTSRGNPKSPQKPIVRVFLPN
KQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELH
VEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNY
DQLDLLFVSKFFEHHPISRDEASSGGTTPVSALYPAVTPSDPSGPLCPPTASPSKSIPIP
QPFRPGDEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIGDQGLQRGDGVPLSQPSRCL
QKYRSRTPSPLLYSYPNDIVFDFEPGPVFRDIGSTTGLSATPPASLPGSLTNVKALQKSP
GPQRERKSSSSSEDRNKMKTLGRRDSSDDWEIAEGQITMGQRIGSGSFGTVYKGKWHGDV
AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH
LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNSILLALDFTDKAGKIREGRL
TLKWSGSSQGQGGRLSLFCIAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYLNIN
NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKREERPLFPQILASIELLARS
LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGGYPYSEV
Download sequence
Identical sequences H3AT03
ENSLACP00000012774 ENSLACP00000012774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]