SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012851 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012851
Domain Number 1 Region: 485-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-79
Family Protein kinases, catalytic subunit 0.0000231
Further Details:      
 
Domain Number 2 Region: 325-439
Classification Level Classification E-value
Superfamily PH domain-like 8.03e-35
Family Pleckstrin-homology domain (PH domain) 0.0000203
Further Details:      
 
Domain Number 3 Region: 166-229
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.3e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 35-102
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012851   Gene: ENSLACG00000011315   Transcript: ENSLACT00000012945
Sequence length 797
Comment pep:known_by_projection scaffold:LatCha1:JH126749.1:590347:743088:1 gene:ENSLACG00000011315 transcript:ENSLACT00000012945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFPECGFFGMYDKILLFRHDLNSENILQRLTSAEEIHEGDLIEVVLSALATVEDFQIRPH
TLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEECTVTLHKNQCPFRSCQRTIGVRINRVPG
SLISGKPNLVIDRHMQTQGAALTTRITRTHQEPGKRIPSWSGRPIWMEKMVMGRVKVPHT
FVVHSYTRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPKDCLGEVVFNGEPAS
PGPDSDMPMEVDSNDLNSDGGRGLDDSEEPSTSEEKIFFLDSSDLDGDKDEEPTKTISPS
ASNNIPLMRVVQSVKHTKRKSSTMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNETG
SKYYKEIPLSEILQVDPARDFRTLAQGSNPHCFEIITDSMVYYVGENNGGNYQNPVLAAS
GVGFDVAQSWEKAIRQALMPVTPQASICTAVGQGKDHKELSISISVSNCQIQENVDISSV
YQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHP
GIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERNTKFLVTQILVALRHLHFK
NIVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGY
NRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWKETSGEAIDLINNLL
QVKMRKRYSVDKSLSHPWLQDYQTWLDLREFETRIRERYITHESDDARWEEYADEHNLVY
PKHFIMAPNVDDMEEDP
Download sequence
Identical sequences H3AT80
ENSLACP00000012851 ENSLACP00000012851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]