SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013404 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000013404
Domain Number 1 Region: 249-572
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-56
Family Diacylglycerol kinase-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000013404
Domain Number - Region: 120-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.014
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 82-101
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0593
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013404   Gene: ENSLACG00000011803   Transcript: ENSLACT00000013500
Sequence length 592
Comment pep:known_by_projection scaffold:LatCha1:JH126628.1:638226:707891:1 gene:ENSLACG00000011803 transcript:ENSLACT00000013500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLFFYCNFRKAISRSGLQHLASMHTAFPVMTNGPAKELRTVVDWSENAVNGEHLWLETN
ASGDLCYLGEENCLVKIAKSASRRKCAACKIVVHTVCIEQLEKINFRCKPTFREGSSRFL
RDNLVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVACFMLHQ
IEEPCSLGAHAAVVIPPTWVIKVKKPQNSFKCSNRRKKRTSFKRKASKKGAEKESKWRPF
AIKPISSPLMKPLLVFVNPKSGGNQGTKVLQTFMWYLNPRQVFDLSKEGPKEALELYRKV
PNLRILACGGDGTVGWILSVLDELQLSPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSK
ILCHVEDGNIVQLDRWNLRVERNPEFPQEESEDGSHRLPLSVFNNYFSLGFDAHVTLEFH
ESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLAKHVKVVCDGSDLTPKIQELKFQC
IVFLNIPRYCAGTMPWGNPGEHRDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQC
REVTLTTYKTIPMQVDGEPCRLAPSVVRISLRNQANMVQKSKRRTSMPLLNE
Download sequence
Identical sequences H3AUT3
ENSLACP00000013404 ENSLACP00000013404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]