SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013608 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000013608
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-36
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 289-409
Classification Level Classification E-value
Superfamily TIMP-like 3.61e-35
Family Netrin-like domain (NTR/C345C module) 0.00038
Further Details:      
 
Domain Number 3 Region: 151-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-33
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013608   Gene: ENSLACG00000011980   Transcript: ENSLACT00000013704
Sequence length 409
Comment pep:known_by_projection scaffold:LatCha1:JH127415.1:659304:696219:-1 gene:ENSLACG00000011980 transcript:ENSLACT00000013704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVICSFFGVLLAARILGQQPGQRRTFTCGGNLAGESGYIGSEGFPGVYPPNSKCTWKI
TVPEGKVVVLSFRFIDLESDTLCRYDFVDVYNGHANGQRLGRFCGTFRPGAIVSSSNKML
VQMVTDANTAGNGFIAMYSAARPNERGEQYCGGRLDKPSGSFKTPNWPDRDYPAGVTCSW
HIVAPRHQIIEIKFEKFDVERDNYCRYDYIAVFNGGEINDAKRIGKFCGDSPPAPILSDG
NELLIQFLSDLSVTADGFIGYYRFRPKRLSTTTVPPPTTPATTFKPTVALCQQKCRRSGT
LESNYCSSDFAITGTVITVIAREGSLHATISIINVYKEGNLAIQQAGKSMSTKVIVVCKK
CPFIRRGFNYIFMGQVDEEGRGKLLPNSFVMGFKTKNQKSLNALKTKQC
Download sequence
Identical sequences H3AVD7
ENSLACP00000013608 XP_006002847.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]