SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013847 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000013847
Domain Number 1 Region: 270-403,717-775
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.72e-34
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-29
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 172-239
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.38e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000428
Further Details:      
 
Domain Number 4 Region: 110-166
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013847   Gene: ENSLACG00000012190   Transcript: ENSLACT00000013944
Sequence length 781
Comment pep:known_by_projection scaffold:LatCha1:JH127631.1:687173:780397:1 gene:ENSLACG00000012190 transcript:ENSLACT00000013944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTSIKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDAKSLIFDEVDLSDASVAESSTKNV
NNSFTIITPFRRLILCAENRKEMEDWITSLKSVQTREHYETAQFNVEHFSGMHNWYACSH
ARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRAINNCKWTTLASIGRDIIEDEDG
IAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWRCLWCKAMVHTACKDPYPRKCPLGQC
KVSIIPPTALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQV
FDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDRLNLHKQCHLGVLPLGTGND
LARVLGWGGSCDDDTQLPQILEKLERASTKMLDRWSIMTYEIKIPPKPSSLPLTPEEESE
ECQFQISAYEDSVAAHLTKILNSDQHSVVISSANQRVLCETVKDFVAKVGKTYEKPAENT
DEADAMAIKCSVLNEKLDSLLQALQTEAHATSLPSHSTPPIVEEEVEEFSSEESLSESKE
QLIESISSKSSAQKIFKPREQLMLRANSLKKAVRQIIEQAEKVVDEQNAHTQEQVPQSPT
EFRKEEEDTKEEEKEEDTKESESASLVRVAPRSPPERRVSRSTHSYTGSFSIPPLTTSKE
NLPVLNTRIICPGLRAGLAASIAGSSIISKMLLANIDPFGATPFIDPDPDSLEGYSEKCV
MNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQKVQL
E
Download sequence
Identical sequences H3AW26
ENSLACP00000013847 ENSLACP00000013847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]