SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014088 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014088
Domain Number 1 Region: 31-235,277-355
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000623
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000209
Family Hormone receptor domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014088   Gene: ENSLACG00000012400   Transcript: ENSLACT00000014187
Sequence length 399
Comment pep:known_by_projection scaffold:LatCha1:JH127074.1:712348:746343:1 gene:ENSLACG00000012400 transcript:ENSLACT00000014187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFSSPGVLYRNCTVRGWQEPSPDYPIACKVDDMEPENQSSYYATFQDVYTAGYATSLISL
ITAFVIFALFRKFHCTRNYIHMHLFMSFILRAVAVFTKDAILFTDEDLNHCLVSTVSCKA
AISFFQFSILANFFWLLVEGMYLQTLLALTFISEKQYFWWYIIIGWGTPAAVLAVWTLFR
VYSENTGCWDDNANVGIWWIIKGPILFAVLVSNILSTNAAFSVVILRVSSGTFGDTDWSF
VRNSCCLGVSLGDDAVTVSWKMHALVLMRYLVSKCFCCRRLAKSTLLLIPLFGVHYIVFA
FFPEDTGFDDARLFLELGLGSFQGFVVALLYCFLNGEVQAEVKKRMGRLRYQGYLAFSQR
HRASSTESSVINFVTQFSLLEKLSPKRKPSGYQNCRVTV
Download sequence
Identical sequences H3AWR7
ENSLACP00000014088 ENSLACP00000014088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]