SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014260 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014260
Domain Number 1 Region: 67-268
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.33e-56
Family AlkB-like 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014260   Gene: ENSLACG00000012552   Transcript: ENSLACT00000014360
Sequence length 272
Comment pep:known_by_projection scaffold:LatCha1:JH127626.1:734256:744062:1 gene:ENSLACG00000012552 transcript:ENSLACT00000014360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFVIVKQKSNGKRKHGMEEKGGANDDDDLIFNNKCKAQLKKKIKGEEAKDNDDILQKE
ECLLEYKWKKIKAVGLDCDYTKLFTKLEADDIFQQLERELEYFSGDLTRIQVFGKTYNIP
RKQVTYGDSGLIYTYSGVTLAPKPWIPILESIRDRVTKATGHTFNFVLINRYKDGNDHIG
EHRDDERELDPRSPIASVSFGACRDFIFRHGASRGKNPTQKIEPIKLELEHGSLLMMNYP
TNVYWYHSLPVRKKIPVPRINLTFRKIVPLKK
Download sequence
Identical sequences H3AX89
ENSLACP00000014260 XP_006004616.1.90931 ENSLACP00000014260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]