SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014294 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000014294
Domain Number - Region: 190-393
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000286
Family YVTN repeat 0.042
Further Details:      
 
Domain Number - Region: 468-528
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00209
Family Hormone receptor domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014294   Gene: ENSLACG00000012580   Transcript: ENSLACT00000014394
Sequence length 774
Comment pep:novel scaffold:LatCha1:JH126843.1:737387:860867:1 gene:ENSLACG00000012580 transcript:ENSLACT00000014394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSESCQLASLINFFVISTYVHLFCLSRAALPFGLMRRELACEGYPIELRCPGSDVIMIE
TANYGRTDDKICDADPFQMENVQCYLPDSYKIMSQRCNNRTQCVVVAGSDAFPDPCPGTY
KYLEIQYECVPYIFVCPGTLQKVLESTSTHESEHQSGAWCKDPLQAGDRIYFMPWIPYRT
DTLTEYASWDDYVAGRPTTTYRLPNRVDGTGFVIYDGAVFYNKERTRNIVKYDLRTRIKS
GEAIIGNANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEANNGRLVVSQLNPYTLRFEG
TWETGYDKRSASNAFMVCGVLYVVRSVYEDDDSELTGNRIDYAYNTNLNREEPISIAFSN
PYQFVSSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSTGPVTMTPITTTTSTRPTTVTT
TTAIVSTKKFPTRLTTHAFGEINKMAPDPRMITAIMPITKKPLLPSPRGSPEQFCEAKEV
RKVQWPATQQGMLVDRPCPKGTKGIASFQCLPLEGVWNPRGPDFSNCTSPWVNQVAQKIK
SGENAANIANELARHTRGQIYAGDVSSSVKLLEQLLDILDAQLQALRPSEKESAGRSYNK
AVVETVDNLLKQNALEAWKDMNSTEQVHTATMLLDILEEGAFLLADNLKEPARIIVSKQN
VVLEVTVLNTEGQVQELMFPQDYPTESAIQLSSNTIKQNSRNGVVKVVFILYNNLGVFLS
TENATVKMAVDPGAGVPSIVVNSQIIAASINKESSRVFLTDPVIFTLSHLEVRN
Download sequence
Identical sequences H3AXC3
ENSLACP00000014294 ENSLACP00000014294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]