SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014410 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014410
Domain Number 1 Region: 391-442,471-669
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.77e-37
Family PhyH-like 0.069
Further Details:      
 
Domain Number 2 Region: 58-173
Classification Level Classification E-value
Superfamily ARID-like 3.14e-30
Family ARID domain 0.00087
Further Details:      
 
Domain Number 3 Region: 318-384
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.15e-17
Family PHD domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1180-1252
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000672
Family PHD domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014410   Gene: ENSLACG00000012681   Transcript: ENSLACT00000014510
Sequence length 1492
Comment pep:known_by_projection scaffold:LatCha1:JH127354.1:750495:848134:1 gene:ENSLACG00000012681 transcript:ENSLACT00000014510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQDEFILPPECPVFEPSWDEFQDPLGYIAKIRPIAEKSGICKIRPPVDWQPPFAVEVDN
FRFTPRIQRLNELEAQTRVKLNYLDRIARFWEIQGSSLKIPNVERRILDLYSLSRVVKEE
GGYESICKDRRWAKVAQHLGYPAGKNIGSLLRSHYERIVYPYEMFKSGTTLAQCNARPHY
DSEEKDREYKPHSIPFRQSVQPSKNNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGA
GPKMMGLGLMAKDKTLKKKDKEVLECPPTVVVKEEPLVEIKTEPQSPLPEVKEEEMEGEE
EERSLSSEPCTKMTMRLRRNNPNTQFVDSYVCRICARGDDDDKLLLCDGCDDNYHIFCLL
PPLPETPKGSWKCPRCVVEQECKKPAEAFGFEQATCEYTLQSFGEMADNFKADYFNMPVH
MVPTDLVEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPSIDRKSKLSPEEEEYAVSGW
NLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTW
YGVPSYAAEHLEDVMKKLTPELFESQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFV
ITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAC
PERLDLNLAAAVHKEMFIMVQEERKLRKALLEKGITEAEREAFELLPDDERQCDKCKTTC
FLSALACYNCPERLVCLYHIDDLCKCPSSKHYLRYRYTLDELPTMLYKLKFRAESFDTWA
DKVKIALEVEDGRKRGLEELKALECEAIDKKFPNNELLQKLRSTLTKAERCVSEALGLVC
TKKPARTRAIQLTVGELKEFLDQINGLPCVIGQVSAVKELLMKVEAFQSKAQAALKELPH
DCSQLQDLQEQGEQLGVDVPELEQLRRQVQQTQWLDQVRETLAASSSSRVTLDVMRSLME
SGCNVAQNPAVEKAMAELQELLTISERWEEKAQICLEARQKHPPATLEAIIKEAENIPVQ
LPNILALKEALTKAWAWIADLEEIQNGDHYPCLDDLEGLVAVGRDLPVRMEELHHLEVQV
MTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGLDSIKRTKWRKEKECSLYKSDVASLG
LSAQDLRDPGSIILAFKEAEQKEKDGILQLQKANLSKPQPPHPGDQTEYCICGQLPSDLM
LQCNLCRDWLHGTCAACPKLSQQKHSLAWWEWDTKFLCPLCMRSRRPRLEVILSLLVALQ
KLPVRLPEGEALQCLTERAITWQDRARQALASKEVAAVLEKLSELRQRLQAEVTKEMIAL
KESSKNEQNLKKDRGREESRESEESTAENGSTTTSVFTLSLSDEHMISSCLPRLEGPVIE
LSPGVRQQLEELMMEGDLLEVTLDENHSIWRVLQAAQHPPLEKLRKLLEIEKSESKVAKA
KGKDSEKKRKRKSERAEYISMPKEELEPKKNRAGESGLLEEETSKLSEVAQN
Download sequence
Identical sequences H3AXN9
ENSLACP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]