SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014460 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014460
Domain Number 1 Region: 100-265
Classification Level Classification E-value
Superfamily RUN domain-like 7.72e-49
Family RUN domain 0.00000015
Further Details:      
 
Domain Number 2 Region: 556-594,635-697
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000014460
Domain Number - Region: 329-432,472-524
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0175
Family DNA repair protein MutS, domain III 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014460   Gene: ENSLACG00000012724   Transcript: ENSLACT00000014560
Sequence length 702
Comment pep:known_by_projection scaffold:LatCha1:JH126614.1:756558:830957:-1 gene:ENSLACG00000012724 transcript:ENSLACT00000014560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAEQDLTLAEGESNKKEQSFGILRLQEEKAGESRSASRGGGGGVGDGRWQAPIFALA
RKASETISGSIPALPKASPAVAASTEHEEWDRKAIKDPMAVERANLLNMAKLSIKGLIES
ALRFGRTLDSDYPPLQQFFVVMEHCLKHGLKVKKSFLGYSKSIWAPMELVEKLCPEAGEI
AASVRDLPGLKTPLGRVRAWLRLALMQKKLADYLRCLITRKDLLSDFYDYHALMMEEEGA
VIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSLYLRNEEDSYRSEERNGQIAAILDQKN
YVEELNRQLNSTVTSLQARVDSLEKSNTKLIEELAIAKNSIIKLQEENHQLRNENTLILM
RTQHQLETAKVDVDAELDTYKQSRQGLDEMYNEARKQLREESQLRQQKTIDAYLVWDLSI
NKENIVFLQNTVKDIHYNTIITHQQSQGIVAIRVVQVQETQGSEDGLSQKNEIISRLEEK
TNQITATMKQLEQRLQQAEKGRQAAEDGVRKFKQEFTSKSDSLQKQILKREKQLLQLETD
WKIEKEWRQTLQNDLDREREIISELKTETEQMNGLKKEFLRLQEENTQLKRICEEQEQAL
QELGFKLSESKLKIEDIKEANKVLQGGGGGQGWLKDKDATHCKLCEKEFSLSRRKHHCRN
CGEIFCNACSDNELPLPSSPKPVRVCDTCHAMLLQRCSSNST
Download sequence
Identical sequences H3AXT9
ENSLACP00000014460 ENSLACP00000014460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]