SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014814 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000014814
Domain Number - Region: 465-509
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00229
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014814   Gene: ENSLACG00000013042   Transcript: ENSLACT00000014918
Sequence length 550
Comment pep:known_by_projection scaffold:LatCha1:JH126605.1:801211:815560:-1 gene:ENSLACG00000013042 transcript:ENSLACT00000014918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGATEQRDEVSEFLKQNRQLAEWVEALRGECESEKHWAARRHFILRNLEGFDIKPPG
GPFPNLNRLLSLSMVWANHVFLGCRYPQAVMEKVLELAEGIDVLDAPSRTTRDDLVVKMK
KRGLSSSNVILEKQCINCVITTDQNKTPLRDSNDTRKKTSIKALERERKIIAGTIKKTSK
ITKLKRSCREALHINSNLSIVNRAENCAGSYHSSSSFLSCIGAKCTEKQVDSNHFAPTMA
VLAPMVKHSLNLCPNQKTEEAKETCRKKKSAFKEDNGCSKNVRNEICGEARANHTNLQWQ
NPLPSTSSNQTVAKLVATLSGQRTIMTSNEKAINSHLMPPFAGHELQKQNLIPAPLESRL
CTNFFHHVKNGSLQNSQPSPQECASKGGETSIIPSYKLTPETVKDRQTFYNRLYKAVAWK
LVSAGGFSPNLNHLGILNSCIESIKATLDSYFLPLKDISDLPYNKASSENIVCELRCKSV
YLGTGCGKSEENAKVVASREALKLFLKKKVIVKIMKRKYKGRDIEDLVLLDEESKPLNLP
PALRNPQEIY
Download sequence
Identical sequences H3AYU3
ENSLACP00000014814 ENSLACP00000014814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]