SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014878 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014878
Domain Number 1 Region: 39-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 8.24e-39
Family Frizzled cysteine-rich domain 0.0000737
Further Details:      
 
Domain Number 2 Region: 172-290
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000863
Family Netrin-like domain (NTR/C345C module) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014878   Gene: ENSLACG00000013095   Transcript: ENSLACT00000014982
Sequence length 297
Comment pep:novel scaffold:LatCha1:JH127506.1:807904:813311:1 gene:ENSLACG00000013095 transcript:ENSLACT00000014982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFIMAHLTSFCVLLILWAIPSQMEAFPFVLSELSTRKNTCKAIPSTMTLCHGLGYNEMRL
PNLLGHETIKETLQQANSWVPLLTKQCHLDTKKFLCSLFAPVCITDLEEAVYPCRSLCEA
VRDGCAPVMAAFGFPWPQMFNCSRFPMGNGLCVPLAGSENKLPPTKEDRKTCIACQYNGD
DVSAILDNFCRTEFALKMKVSDVSEQSGDLRVTPQSKSRAVYKHGGWSEEDLRRPVLWLA
GGAECACEGLRDPSGDATFLVTGQKVDDRLVISLLWRWQKGQKEMKKMTRTLRKLQC
Download sequence
Identical sequences H3AZ07
ENSLACP00000014878 ENSLACP00000014878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]