SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015049 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015049
Domain Number 1 Region: 164-244
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-26
Family Translational machinery components 0.0036
Further Details:      
 
Domain Number 2 Region: 82-153
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.2e-22
Family Ribosomal S5 protein, N-terminal domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000015049
Domain Number - Region: 20-47
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.0932
Family Ribosomal proteins L15p and L18e 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015049   Gene: ENSLACG00000013242   Transcript: ENSLACT00000015155
Sequence length 290
Comment pep:known_by_projection scaffold:LatCha1:JH127454.1:828478:841071:-1 gene:ENSLACG00000013242 transcript:ENSLACT00000015155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDAGGRGGFRGGFGTGGRGRGRGRGRGRGRGRGARGGKADDKEWVPVTKLGRLVKDMK
IKSLEEIYLFSLPIKESEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYN
GHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVR
LIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISRTYSYLTPD
LWKETVFTKSPYQEFTDHLAKTHTRVSVQRTQAAAAVVAAAAAAAAAPTT
Download sequence
Identical sequences H3AZH8
ENSLACP00000015049 ENSLACP00000015049 XP_006003156.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]