SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015119 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015119
Domain Number 1 Region: 356-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-93
Family Protein kinases, catalytic subunit 0.000000000425
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.06e-24
Family PLC-like (P variant) 0.00000264
Further Details:      
 
Domain Number 3 Region: 216-282
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-22
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0001
Further Details:      
 
Domain Number 4 Region: 140-209
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.99e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015119   Gene: ENSLACG00000013307   Transcript: ENSLACT00000015225
Sequence length 688
Comment pep:known_by_projection scaffold:LatCha1:JH126666.1:737811:903929:1 gene:ENSLACG00000013307 transcript:ENSLACT00000015225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLRICFTSHELGPLQNQGEPCIPFCAVKMKESLTTDRGKTLVQKKPTMYPDWKSYFD
AHIYEGRVIQIILMKAAEDPLSEVTVGVSVLAERCKKGNGKADFWLDLQPQGRILMSVQY
FVEDTDCKQSMREEEGIVTLNRRRGAIKQAKVHAIKNHEFIATFFRQPTFCSVCTDFVWG
LNKQGYKCRQCNAAIHKKCIEKVIWRCTGTAANSRDTVFQKERFNIDVPHRFKTYNYMSP
TFCDHCGSLLWGLVKQGLKCEECGMNVHHKCRTKVANLCGINRKLMAEALAQISQKSTSR
KSDSGLGDSAIGIYQDFKSKEPAIPGADSSFDGPYEKLWEGTTPRPTSRISTLSKLTMDN
FTFQKVLGKGSFGKVMLAELKGKNEFFAVKALKKDVVLIDDDVECTMVEKRVLALAWENP
FLTHLYCTFQTKEHLFFVMEYLNGGDLMFHIQDKGRFELYRAMFYAAETVCGLQFLHSKG
IIYRDLKLDNVMLDRDGHIKIADFGMCKENVFGDIRATTFCGTPDYIAPEILLGQKYTFS
VDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRMDTPHFPRWITKESRDILEKFFEREPT
KRLGITGNIRQHSFFKTINWTALEKREVEPPFKPKVKSAGDYSNFDREFLSEKPRLSHSD
KNLIDSMDQSAFQGFSFINPNMEQLLEK
Download sequence
Identical sequences H3AZP8
ENSLACP00000015119 ENSLACP00000015119 XP_005991787.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]