SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015179 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015179
Domain Number 1 Region: 2-69,98-147
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.88e-27
Family Hormone receptor domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015179   Gene: ENSLACG00000013363   Transcript: ENSLACT00000015285
Sequence length 337
Comment pep:known_by_projection scaffold:LatCha1:JH127074.1:848286:895963:-1 gene:ENSLACG00000013363 transcript:ENSLACT00000015285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAMHSDCIIKKEQEICLAKIKQEETFNDSFVGCPGMWDNITCWQSAAIGETAFVHCPLL
FQIISSEDVTEIHTHTHTHTHTHTSVYLSIYLVGVNLGIIYRNCTEEGWSEPFPHYFDAC
GFDENEIEPDNQDYYYLSVKALYTVGYSTSLVSLTVAMVILCRFRKLHCTRNFIHMNLFV
SFILRAISVFIKDGVLYDREDSKHCLIFTVSQRVLPVSIHYCCIQNCFPWTYSKKTMLFN
TLLIYFVYKEKKIYPWHTSVSLSTPTVCVTIWAVLRLHFDDTGCWDMNDNTALWWVIKGP
VVGSIMVNFVLFVGIIIILVQKLQSPDIGGNESSIYL
Download sequence
Identical sequences H3AZV8
ENSLACP00000015179 ENSLACP00000015179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]