SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015180 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015180
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.71e-24
Family Hormone receptor domain 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015180   Gene: ENSLACG00000013363   Transcript: ENSLACT00000015286
Sequence length 277
Comment pep:known_by_projection scaffold:LatCha1:JH127074.1:848286:887692:-1 gene:ENSLACG00000013363 transcript:ENSLACT00000015286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPGMWDNITCWQSAAIGETAFVHCPLLFQIISSEDDLGIIYRNCTEEGWSEPFPHYFDAC
GFDENEIEPDNQDYYYLSVKALYTVGYSTSLVSLTVAMVILCRFRKLHCTRNFIHMNLFV
SFILRAISVFIKDGVLYDREDSKHCLIFTVSQRVLPVSIHYCCIQNCFPWTYSKKTMLFN
TLLIYFVYKEKKIYPWHTSVSLSTPTVCVTIWAVLRLHFDDTGCWDMNDNTALWWVIKGP
VVGSIMVNFVLFVGIIIILVQKLQSPDIGGNESSIYL
Download sequence
Identical sequences H3AZV9
ENSLACP00000015180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]