SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015552 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015552
Domain Number 1 Region: 483-811
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.79e-46
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 6-95,186-213
Classification Level Classification E-value
Superfamily EF-hand 2.57e-36
Family EF-hand modules in multidomain proteins 0.0042
Further Details:      
 
Domain Number 3 Region: 180-302
Classification Level Classification E-value
Superfamily EF-hand 6.84e-21
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 4 Region: 285-351
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.79e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 5 Region: 355-420
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000124
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015552   Gene: ENSLACG00000013689   Transcript: ENSLACT00000015660
Sequence length 823
Comment pep:known_by_projection scaffold:LatCha1:JH126659.1:896021:949528:-1 gene:ENSLACG00000013689 transcript:ENSLACT00000015660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTMSENKEWATLSPDEFTQLQQYIEYSSKKLEDVLKEFQESGRFSKHNNEESIGFKEFRE
FMKTYLDAKDLPDNLCKRLFMSFQTGSNDLATQRPPDSNNQSDFIPSGKHFFFPSASQWK
ENVAMVVLGLEDSGMQLLKSVKGHYRGKKRPADVGKTTMYQPLRTGLQRGKPEKSVLIKR
RAHESSGLASVKDVSCYLSLLEGQRPEDKLQFTFKLYDKDGNGLLDSSEVDRIITQMMRV
AKYLDWDDTELKPILEEMMKEIDYDGNGTVSMEEWIKGGITNIPLLVLLGLETNVKDDGQ
HMWRMKHFNRPAYCNLCQNLLVGIRKQGLCCTFCKFTVHERCARKAPPDSCIRTYAKSRK
DTSVQSHVWIEGSCDANKCNKCQKKIKSYQGLTGLCCVWCHVKIHNDCLSQVSPVCNCGE
LKDHILPPSAIYPVILERQNSQKNGAQPEDTSQSFTTQEGQVLRKISAKTWPRLGIYITP
VPDTHPLLVFVNLKSGGKQGERVLRKFQYLLNPRQVYNLSKGGPAPGLNFFSDVPEYRIL
VCGGDGTVGWILDAIDKVNLAVRAPVAVLPLGTGNDLARCLRWGGGYDGENLVKILKDIE
QSTIVPMDRWSIKVIPENTDEEGDPVPYEIINNYFSIGVVKKLAKTLHMRDSHRFHFGMK
NKLWYFEFATSETISATCKKLEESISVQVLPLSQPHSNQVVNLYSGKPQHFPNTFQLKQK
RTIKKTRRVQPQFIAVSFSDLSDRRLELVGLEGAIEMGQIYTGLKSAGRRLAKCSEITIR
TSKPLPMQIDGEPWMQSPCTIKISHKNQAPMLMAPPPRSASFL
Download sequence
Identical sequences H3B0Y1
ENSLACP00000015552 ENSLACP00000015552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]