SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015584 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015584
Domain Number 1 Region: 50-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.32e-39
Family Frizzled cysteine-rich domain 0.0000642
Further Details:      
 
Domain Number 2 Region: 175-304
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-24
Family Netrin-like domain (NTR/C345C module) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015584   Gene: ENSLACG00000013721   Transcript: ENSLACT00000015692
Sequence length 309
Comment pep:known_by_projection scaffold:LatCha1:JH127146.1:900274:1007211:1 gene:ENSLACG00000013721 transcript:ENSLACT00000015692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQGQWKLIAKALLTSVLGLLFLGSAEEYDYYSWQSDNFQNGRFYAKQPQCVDIPRDLKL
CYNVGYKRMRLPNLLDHETMPEVQQQAASWVPLLAKRCHTDTQLFLCSLFAPVCLDRPIY
PCRSLCEAVRDSCAPVMESYGFPWPEMLKCDKFPIDNDLCITVQFGNNQVTQPPVPKACP
PCDNELKSDVILEHFCASDFALKMKIKEARNEKGDRRLTAAQKKKVLKMGTLKKKDLKRL
VLYIKNGATCPCHQLDTFQNTNFLIMGRKVDRQLLLTAIHKWEKRNKELKFAVKYMKTHQ
CPTYHTVFQ
Download sequence
Identical sequences H3B113
ENSLACP00000015584 XP_006000255.1.90931 ENSLACP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]