SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015596 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015596
Domain Number 1 Region: 29-153
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-26
Family Hormone receptor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 117-434
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000119
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015596   Gene: ENSLACG00000013730   Transcript: ENSLACT00000015704
Sequence length 546
Comment pep:known_by_projection scaffold:LatCha1:JH126776.1:901234:930776:-1 gene:ENSLACG00000013730 transcript:ENSLACT00000015704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSACMNCILLLILCSFLSSIYALVDADDVITKEEQIYLLVDAKIKCEKNINIQLENIE
DRHCLPEWDGIICWPKGSLNEFVSVQCPKYIYDFNHKGHAYRKCDSVGNWKLALSINKTW
ANYSECTEFLNLEQRSKEKEVFDRLYMMYTVGYSISVTSLVVAVFILCCFKRLHCTRNYI
HIHLFASFICRAVSIFVKDTVLYSEIMPEELDKMRVGDLKEDLESRLGHRTQLAGCKAAV
TVFLYFLATNHYWILVEGLYLHSLIFMAFLSDKNYLWALTIIGWGVPAVFVSVWASVRAS
LADTQCWDLSAGNLKWVYQVPILAAIMMNFFLFLNIVRVLASKLWETNTGKLDPRQQYKR
LLKSTLVLMPLFGVHYVVFMAMPYTEVSGMIWQIQMHYEMLFNSSQGFFVAFIYCFCNGE
VQAELKKAWFRRNLALDLKQKTRVTSTGGSYYYGGMVSQSTNSASVSMAVRGASVGGLNF
SGKHRVLPLHSVTNTPGYIPSTSVSENSLLLSATKEINKKQPRETTKELTHQEQEINHCQ
EFETVL
Download sequence
Identical sequences H3B125
ENSLACP00000015596 XP_005994703.1.90931 ENSLACP00000015596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]