SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015659 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015659
Domain Number 1 Region: 149-427
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.79e-52
Family FCH domain 0.0043
Further Details:      
 
Domain Number 2 Region: 629-848
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000922
Further Details:      
 
Domain Number 3 Region: 573-623
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015659   Gene: ENSLACG00000013785   Transcript: ENSLACT00000015767
Sequence length 1026
Comment pep:known_by_projection scaffold:LatCha1:JH126867.1:909561:956528:-1 gene:ENSLACG00000013785 transcript:ENSLACT00000015767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFTENQESRRRLAHECLGEVLRILRQVINKYPLLNTVETLTAAGTLISKVKGFHYESSNE
ADKKEFEKAIETMAVAFSSNVSELLMGEVDSSTLLSLPPTDKSRSMENLYGGIPGQGLDI
AQMKNDFIDSVTGSIIAEEVDIMLQRYEGGVESALQYAKIISKYMKDLIYYLEKRTTLEM
EFAKGLQKLAHTCKPILTQEHYMPFFSIYGLALEQDVEYGHGVVQMASTLQNQTFLQPLS
VRRQEHEKRRKEIKEQWHRAQKKLQDAEANLRKAKQAYMQRCEEHEKAKYTTVKAEEDQQ
NTSSNATKSLDKKRKLAEEARNKAEEAEATYRVCIADAKTQKQELEDVKVNVLRQIQEVI
KQSDQIVKSATVSYYQIMHMQTAPLPVHFQTLCESSKLYDPGQQYASFVKGLQKEDESES
HYDFEPYVPPNTCSPSARSRVPSFNTQDAAASSGSEAQGEETGNDEGSNVQKEHRSSGVF
GGRGHQVHKSWPTTVSDADSVFVHLFIGEFARKLPRTPSSGTMSSNEELDEKGGNEVSFE
QKKKIKLGINGIAPEITVPTGPFRNVGLSKAAQTHRLRKLRTPSKCRECDSYVYFQGAEC
EECYLACHKKCLETLAIQCGHKKLQGKLQLFGRDFTQASQDCPNGIPFIIKKCISEIEKR
ALKMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQIPEPLMPFR
LYNDLMGLAKESLQGGPEGEAGKGPELVDKGPQTDKEIVIIVTKLKELLKELPDANMATL
QFIVKHLKRISELEQDNKMTPSNLGIVFGPTLMRPRPTEATVSLSSLVDYPHQARIIETM
IVFYAVIFESGQLNFFVQGTCLPQGGGGNNALATQPIFQAEQIDSVELFFFSSPPPPANS
LDSSESRERSIDSDFELEDGETNICDDNEGQISRTSSIGQAQEQHSSTDSLSQQPVMDEE
NKTDSDVSISNQTEDENAETQRKPLSEYNVNQSNNKQVSNRYLPVVWMRNGKIVVDIERD
REPEFV
Download sequence
Identical sequences H3B188
ENSLACP00000015659 ENSLACP00000015659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]