SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015728 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015728
Domain Number 1 Region: 247-327
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-22
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 2 Region: 73-132
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000015728
Domain Number - Region: 43-53
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0222
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015728   Gene: ENSLACG00000013852   Transcript: ENSLACT00000015838
Sequence length 375
Comment pep:known_by_projection scaffold:LatCha1:JH127045.1:918911:951274:1 gene:ENSLACG00000013852 transcript:ENSLACT00000015838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLQRLKRSLSFKTILRSKSVENFFQRSNSEVKFPPELLLNSEPPPPPSPPPLPTVPEPLP
PMEQPSTPVQKPLALLKPMRTHSFQEYLFKKPSFCELCQHVIVGNSKQGLRCKTCKVSVH
LWCSEEVSHQQCIGRVPTGFRRNFSSPLISIQHGLTKETPPNASGSRVDPVYETLRYGTS
LAQMSRSSFGSVSESPTRSLSEKDESVEDADEYTKSSEDSHSDNGFTPLENERIVTEQKN
YLQVQKTPPRKDVPPMHCYVALYKFLPQEQNDLELQPGDRVMVIDDSNEDWWKGKIGDRV
GFFPANFIQRVRPGESVWSFSSQPYKTNEESQVSHSSLKTLFQICIGKADDTNGLLKVSS
GKKRGYVPVGALEEI
Download sequence
Identical sequences H3B1F7
ENSLACP00000015728 ENSLACP00000015728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]