SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016034 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016034
Domain Number 1 Region: 89-418
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-79
Family Protein kinases, catalytic subunit 0.00000366
Further Details:      
 
Domain Number 2 Region: 953-1019
Classification Level Classification E-value
Superfamily G protein-binding domain 5.75e-24
Family RhoA-binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1139-1231,1282-1316
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000271
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 1232-1285
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000122
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000016034
Domain Number - Region: 712-780
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00018
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number - Region: 428-530
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000235
Family Myosin rod fragments 0.0021
Further Details:      
 
Domain Number - Region: 539-645
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016034   Gene: ENSLACG00000014120   Transcript: ENSLACT00000016145
Sequence length 1350
Comment pep:known_by_projection scaffold:LatCha1:JH126833.1:966491:1051517:1 gene:ENSLACG00000014120 transcript:ENSLACT00000016145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSEPESLETKQGLILILFLNHTFSFSIFCCVDGLDAMVYDLDFPALRKNKNIDNFLNRFF
KTSLSFLRDLYLGDKEDYDVQLDIFFGGGGVQEVRHKVTRKVYAMKLLSKFEMIKRSDSA
FFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDMPEKWARFYT
AEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPD
YISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTF
PDDSEISKEAKNLICAFLTDREVRLGRNGVEEIKRHPFFRNDQWTWESIRDTAAPVVPEL
SSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNHRYFTGPVSSPNENRTS
SNVDKSHLENLQKKIYQLEEQLQNEMQLKDEMEQKCRTSNIKLDKIMKELDEEVNQRKSL
DSAVSQLEKEKLMVHHRINEHQRKAEQENEKRRNAENEVSTLKEQLEELKKISQTSQITN
EKMTQLQKQLEEANDLLRSESDTAARLRKSQTEMTKSMSQLETVNRDLQERSRTLENTKA
QLEKDNLQLQMALDSERRDRSHGSEMIGDLQARITSLQEEVKNLKLTLSKVETERKQAQD
MLNNSEKEKNNLEIDLAYKLKTLQQRLEQEINEHKVTKAHLADNYESIEEAKSVAMYGME
QKFKEERVMRQKAEARVVEVEKQCSMLDFDLKKSQQKVEQLIKQKESLEEEVKNLTLQLE
QETNKRTMTQNELKTVAFTADNLKGSEKQLKQEINSLLEAKRLLEFELAQLTKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEEIAENKKQNTDFQKRVHELQNERDSFSAQLDL
TVTKAESEQLARALLEEQYFELNQETKKAATRYKQEVSEKDNTIELLEESNKTLTKDVDN
LAKEKAELDEKLKKKEEEYQTQKEETISNIKASYEKILNTERTLKTQAVNKLAEIMNRKD
MKIDRKKSSTADLRKKEKENRKLQLDLNQEREKYNQLIVKYQRELNEMQAQLVEENTFKT
ELQMQLASKESDNEQLRAKLMDLQLRVDNTSVASLQPDEVDGNVIVGSSCIPYLCIFYSF
SQSRIEGWLSVPNRANIKRYGWKKQYVVVSSKKILFYNHEQDKEQSNPSMVLDIDKLFHV
RPVTQGDVYRAETDEIPRIFQILYANEGECRIYHFPANCEACAKPLWHVFKPPPALECRK
CHVKCHKDHLDKKEDMITPCKMNYDVTSARDMLLLACSQEEQKKWIGHLVKKIPKAPPMS
FMRGSPRTLSTRSTNQSFRKNVKNTASKPR
Download sequence
Identical sequences H3B2B3
ENSLACP00000016034 ENSLACP00000016034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]