SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016136 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016136
Domain Number 1 Region: 17-272
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.92e-43
Family Rhodopsin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016136   Gene: ENSLACG00000014213   Transcript: ENSLACT00000016248
Sequence length 273
Comment pep:novel scaffold:LatCha1:JH126588.1:983822:984742:-1 gene:ENSLACG00000014213 transcript:ENSLACT00000016248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNVVDVGIEASSKVCDIIDPVQFIMVPLVYIMVLCIGLPGNFIALMVFLLDKDKIGKAIR
VYLINLTVADILFNISLPFWIVYYLKGGDWTFGDVVCRMTGAIYYLATYSAITFMTIISF
NRYCTILQCKVKLSLNSYKGAICICVVAWLFWIVASVGFFVLSFTLVLVTYVSVMRSLSA
SNPSQSQGTHRRLAKIMVLGMVVVFVVCIAPYHIILVPWVMGRTLSLDCVSSSIIDILHW
VSIALLSLNSCIDPLIYCFSVKRFRVDFLKTIR
Download sequence
Identical sequences H3B2L5
ENSLACP00000016136 ENSLACP00000016136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]