SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016178 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016178
Domain Number 1 Region: 387-543
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.5e-30
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 84-197
Classification Level Classification E-value
Superfamily EF-hand 1.18e-23
Family Calmodulin-like 0.06
Further Details:      
 
Domain Number 3 Region: 178-248
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.13e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 4 Region: 252-314
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000583
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016178   Gene: ENSLACG00000014250   Transcript: ENSLACT00000016290
Sequence length 543
Comment pep:known_by_projection scaffold:LatCha1:JH127061.1:991435:1190885:-1 gene:ENSLACG00000014250 transcript:ENSLACT00000016290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLQTLDFEGFTLFMKTFLEADLPDCFCQHLFMSFSNRLAQPSLETQAKTLGTSPLLAGG
LKMIKNNSSPPSVPCTAVSEPPQVIQLKQIVCYLSLLEGGRPEDKLEFMFRLYDTDGNGY
LDSSELENIISQMMHVAEYLEWDVTELKPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIP
LLVLLGLEANVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVS
RAPHSCIKTYVKSKKDSNVMHHFWVEGNCHTKCDKCHKTIKCYQGLTGLHCVWCQITLHN
KCASHVKPECEFGTVKDHILPPTAICPVVLQTYPFSGSYVPMERQSTMKREKSGLQQVSR
SGDWNKIQRANSITMDGQGLQITPTPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQV
YSLAGNGPMPGLNFFRDVLDFRVLACGGDGTVGWILDCIDKAVLPKHPPVAVLPLGTGND
LARCLRWGGGYEGESLMKILKDIENSTEVMVDRWKIEVMPNDKDEKGDPVPYSIINNYFS
IGV
Download sequence
Identical sequences H3B2Q7
ENSLACP00000016178 ENSLACP00000016178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]