SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016190 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016190
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000182
Family Double-stranded RNA-binding domain (dsRBD) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016190   Gene: ENSLACG00000014261   Transcript: ENSLACT00000016302
Sequence length 345
Comment pep:known_by_projection scaffold:LatCha1:JH127275.1:993007:1026864:-1 gene:ENSLACG00000014261 transcript:ENSLACT00000016302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVRPQRLQPGIGTGTGTGTLRSLRPGISGSSALPGQPQPQPQPIAFPGLGLASAPPPP
PGLGVGVTVNPGVSFGTVAGNPAVLREAVEAVVKSFAKHTQGYGRVNVVEALQEFWQMKL
SRGADLKNGALVVYEMVPSNAPPYVCYVTLPGGSCFGSFQFCPTKAEARRSAAKIALMNS
VFNEHPSRRITDEFIEKSVSEALATFNGNREEADNPNTGIGAFRFMLESNKGKSMLEFQE
LMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDMRNQMAMDWVNREQEVQGILG
RELTVAERELDEARLAGKELRFHKEKKDILVLAAGQLSNLHPSNC
Download sequence
Identical sequences H3B2R9
XP_006001640.1.90931 ENSLACP00000016190 ENSLACP00000016190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]