SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016327 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016327
Domain Number 1 Region: 414-550
Classification Level Classification E-value
Superfamily TIMP-like 2.12e-28
Family Netrin-like domain (NTR/C345C module) 0.032
Further Details:      
 
Domain Number 2 Region: 193-288
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-21
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 367-422
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 
Domain Number 4 Region: 306-362
Classification Level Classification E-value
Superfamily BPTI-like 1.29e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.006
Further Details:      
 
Domain Number 5 Region: 111-161
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000735
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 29-76
Classification Level Classification E-value
Superfamily Elafin-like 0.000000105
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016327   Gene: ENSLACG00000014385   Transcript: ENSLACT00000016441
Sequence length 556
Comment pep:known_by_projection scaffold:LatCha1:JH126634.1:1016892:1020412:-1 gene:ENSLACG00000014385 transcript:ENSLACT00000016441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANSPSTVLVPVILSLFSVLVEGASLPQLGVSHPGVCPNHLNPNLWVDAQSTCDRECNIDK
DCEGFEKCCTNVCGLKSCVAARFADGSFSQLDVSREKTCENFVCTQQGSDCDIWDGQPIC
KCKDRCEKEPNFTCASDGLTYYNKCYMDAEACIRGIALTVVTCRYHFTWPNTSPIPLETT
AHTTPISSLEESVPPALYTNPFHQSVYIGGTVSFHCDVSGRPRPDIIWEKQSDHQENLIM
RPDQMYGNVVVTNIGQLVIYNAQPEDAGIYTCTARNSAGLLRADYPLSIIKREHLEDSKP
ESPKLLSPGECLKEPDKGDCETHRIRWYYDHRKGTCLTFRYGGCDGSKNHFETYEECKET
CMTESVNMCTLPAVQGPCKNWEPRWAYNSLIKQCHAFIYGGCEGNENNFDTKVACEETCP
FPKHQHCKACKPKSKIIPSFCKSDFAIIGRLTEIIEDQDSGIARIALDEVLKDEKMGLKF
FNSKHLEVTLMGIDWNCPCPNITTEEGPLIIMGEVYDGMAVLDPDSYVRALNDKRIKKIH
EIVEKKTCELLHRFQD
Download sequence
Identical sequences H3B356
ENSLACP00000016327 ENSLACP00000016327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]