SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016526 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016526
Domain Number 1 Region: 626-776
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-38
Family SPRY domain 0.0065
Further Details:      
 
Domain Number 2 Region: 435-534
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-19
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000016
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000707
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000016526
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0732
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016526   Gene: ENSLACG00000014562   Transcript: ENSLACT00000016640
Sequence length 786
Comment pep:known_by_projection scaffold:LatCha1:JH126849.1:1051446:1133210:-1 gene:ENSLACG00000014562 transcript:ENSLACT00000016640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCLACARNILVQTPEAESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAVPPPPHLPPPGLPPI
PRNSCITCPQCHRSLILDDRGLRGFAKNRVLEGVIDRYQQSKTAALKCQLCEKSPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKIATCTDHELENHSMY
CVQCKIPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNCLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLSRVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHITEDQWGKGTLTPRMTTDFDLTLDNA
PLLQSIHQLDFVQMKVPSPVPASPILQLEECCTNNNSATLSWKQPPLSTVQVDGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYSARVKAFNKAGVSQYSKTLVLQTSEAMQGEK
KPRIDCSKEQCTLTFIAPLDSVTVIFLSPNSVTIIIQCIFNYRFNTSFCSDRQNITIHNG
TVQMSIGGKNLECISLGMTTVDIRKVIAVAWFTFDPGSAHPDIIFSNDNHTVTCNSYDDR
VVLGNTGFSKGIHYWELTIDRYDNHPDPAFGVARLDVLKDVMLGKDDKAWAITEGGITKG
ATVGVLLDFNRRTLTFSINDEQQGPVAFESMEGLFFPAVSLNRNVQVTLHTGLPIPEFCT
ARESIQ
Download sequence
Identical sequences H3B3Q5
ENSLACP00000016526 ENSLACP00000016526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]